Name : Recombinant Human C-X-C Motif Chemokine 3, CXCL3, GROγ (N-6His)
Supplier : NOVO
Price :156
SKU : GEN2488647637
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight | 1 kD, 10 |
| UniProt number | P19876 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | (N-6His), CXCL3, GRO&gamma, C-X-C Motif Chemokine 3 |
| Short name | (N-6His), CXCL3, GRO&gamma, Recombinant C-X-C Motif Chemokine 3 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | (N-6His), GRO&gamma, chemokine (C-X-C motif) ligand 3, sapiens C-X-C Motif Chemokine 3, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CINC-2b and GRO3 and GROg and MIP-2b and MIP2B and SCYB3, CXCL3 and IDBG-24221 and ENSG00000163734 and 2921, Extracellular, chemokine activity, this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0008009 and chemokine activity and molecular function this GO :0030593 and neutrophil chemotaxis and biological process, this GO :0008009: chemokine activity, this GO :0008009: chemokine activity, chemokine (C-X-C motif) ligand 3 |
| Identity | 4604 |
| Gene | CXCL3 |
| Long gene name | C-X-C motif chemokine ligand 3 |
| Synonyms gene | GRO3 |
| Synonyms gene name | GRO3 oncogene chemokine (C-X-C motif) ligand 3 |
| Synonyms | SCYB3 GROg MIP-2b CINC-2b |
| Locus | 4q13, 3 |
| Discovery year | 1991-05-21 |
| GenBank acession | M36821 |
| Entrez gene record | 2921 |
| Pubmed identfication | 2217207 |
| Classification | Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT | OTTHUMG00000160861 |