Name : Recombinant Human Caspase-10, CASP10 (C-6His)
Supplier : NOVO
Price :496
SKU : GEN2020128786
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Caspase-10 is produced by our E, coli expression system and the target gene encoding Val220-Ile480 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 1 kD, 30 |
| UniProt number | Q92851-2 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 10 mM DTT, pH 7, 2 um filtered solution of 25 mM HEPES, 5, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CASP10 (C-6His), Caspase-10 |
| Short name | CASP10 (C-6His), Recombinant Caspase-10 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | apoptosis-related cysteine peptidase (C-6His), caspase 10, sapiens caspase-10, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | ALPS2 and FLICE2 and MCH4, CASP10 and IDBG-78470 and ENSG00000003400 and 843, Plasma membranes, apoptosis-related cysteine peptidase, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0006915 and apoptotic process and biological process this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0031265 and CD95 death-inducing signaling complex and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0035877 and death effector domain binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097199 and cysteine-type endopeptidase activity involved in apoptotic signaling pathway and molecular function this GO :0097342 and ripoptosome and cellular component, this GO :0004197: cysteine-type endopeptidase activity, this GO :0004197: cysteine-type endopeptidase activity and also this GO :0005515: protein binding and also this GO :0008234: cysteine-type peptidase activity and also this GO :0031625: ubiquitin protein ligase binding and also this GO :0035877: death effector domain binding and also this GO :0097199: cysteine-type endopeptidase activity involved in apoptotic signaling pathway, this GO :0005515: protein binding, this GO :0008234: cysteine-type peptidase activity, this GO :0031625: ubiquitin protein ligase binding, this GO :0035877: death effector domain binding, this GO :0097199: cysteine-type endopeptidase activity involved in apoptotic signaling pathway, caspase 10 |
| Identity | 1500 |
| Gene | CASP10 |
| Long gene name | caspase 10 |
| Synonyms gene name | apoptosis-related cysteine peptidase , apoptosis-related cysteine protease caspase 10, caspase 10 |
| Synonyms | MCH4 |
| Locus | 2q33, 1 |
| Discovery year | 1997-04-21 |
| GenBank acession | U60519 |
| Entrez gene record | 843 |
| Pubmed identfication | 8755496 |
| RefSeq identity | NM_032977 |
| Classification | Caspases Death effector domain containing Death inducing signaling complex |
| Havana BLAST/BLAT | OTTHUMG00000132818 |
| Locus Specific Databases | CASP10base: Mutation registry for Autoimmune lymphoproliferative syndrome, type II (ALPS2) LRG_33 |