Name : Recombinant Human CD14 (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN9040943596
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human CD14 is produced by our Mammalian expression system and the target gene encoding Thr20-Cys352 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 36, 81 kD |
| UniProt number | P08571 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD14 (C-6His) |
| Short name | Recombinant CD14 (C-6His) |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | sapiens CD14 molecule (C-6His), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD14 and IDBG-49157 and ENSG00000170458 and 929, CD14 and IDBG-646064 and ENSBTAG00000015032 and 281048, Cd14 and IDBG-138525 and ENSMUSG00000051439 and 12475, Extracellular, lipoteichoic acid binding, this GO :0001530 and lipopolysaccharide binding and molecular function this GO :0001847 and opsonin receptor activity and molecular function this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002237 and response to molecule of bacterial origin and biological process this GO :0002755 and MyD88-dependent toll-like receptor signaling pathway and biological process this GO :0002756 and MyD88-independent toll-like receptor signaling pathway and biological process this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006909 and pha this GO cytosis and biological process this GO :0006915 and apoptotic process and biological process this GO :0006954 and inflammatory response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007249 and I-kappaB kinase/NF-kappaB signaling and biological process this GO :0009408 and response to heat and biological process this GO :0009986 and cell surface and cellular component this GO :0010008 and endosome membrane and cellular component this GO :0016019 and peptidoglycan receptor activity and molecular function this GO :0031225 and anchored component of membrane and cellular component this GO :0032026 and response to magnesium ion and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0034134 and toll-like receptor 2 signaling pathway and biological process this GO :0034138 and toll-like receptor 3 signaling pathway and biological process this GO :0034142 and toll-like receptor 4 signaling pathway and biological process this GO :0034612 and response to tumor necrosis factor and biological process this GO :0035666 and TRIF-dependent toll-like receptor signaling pathway and biological process this GO :0038123 and toll-like receptor TLR1:TLR2 signaling pathway and biological process this GO :0038124 and toll-like receptor TLR6:TLR2 signaling pathway and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045471 and response to ethanol and biological process this GO :0045807 and positive regulation of endocytosis and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070891 and lipoteichoic acid binding and molecular function this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071223 and cellular response to lipoteichoic acid and biological process, this GO :0001530: lipopolysaccharide binding, this GO :0001530: lipopolysaccharide binding and also this GO :0001847: opsonin receptor activity and also this GO :0005515: protein binding and also this GO :0016019: peptidoglycan receptor activity and also this GO :0070891: lipoteichoic acid binding, this GO :0001847: opsonin receptor activity, this GO :0005515: protein binding, this GO :0016019: peptidoglycan receptor activity, this GO :0070891: lipoteichoic acid binding, CD14 molecule |
| Identity | 1628 |
| Gene | CD14 |
| Long gene name | CD14 molecule |
| Synonyms gene name | CD14 antigen |
| Locus | 5q31, 3 |
| Discovery year | 1988-05-31 |
| Entrez gene record | 929 |
| Pubmed identfication | 2472171 2462937 |
| RefSeq identity | NM_000591 |
| Classification | CD molecules Scavenger receptors |
| Havana BLAST/BLAT | OTTHUMG00000129507 |