Name : Recombinant Human CD157, BST1 (C-6His)
Supplier : NOVO
Price :1318
SKU : GEN1123158279
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human CD157 is produced by our Mammalian expression system and the target gene encoding Gly29-Lys292 is expressed with a 6His at the C-terminus |
| Molecular Weight | 30, 8 kD |
| UniProt number | Q10588 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | BST1 (C-6His), CD157 |
| Short name | BST1 (C-6His), Recombinant CD157 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | bone marrow stromal cell antigen 1 (C-6His), sapiens CD157, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BST1 and IDBG-10614 and ENSG00000109743 and 683, BST1 and IDBG-643978 and ENSBTAG00000006156 and 616757, Bst1 and IDBG-161385 and ENSMUSG00000029082 and 12182, CD157, NAD(P)+ nucleosidase activity, Plasma membranes, this GO :0003953 and NAD+ nucleosidase activity and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006959 and humoral immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008152 and metabolic process and biological process this GO :0016740 and transferase activity and molecular function this GO :0019898 and extrinsic component of membrane and cellular component this GO :0031225 and anchored component of membrane and cellular component this GO :0050135 and NAD(P)+ nucleosidase activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003953: NAD+ nucleosidase activity, this GO :0003953: NAD+ nucleosidase activity and also this GO :0016740: transferase activity and also this GO :0050135: NAD(P)+ nucleosidase activity, this GO :0016740: transferase activity, this GO :0050135: NAD(P)+ nucleosidase activity, bone marrow stromal cell antigen 1 |
| Identity | 1118 |
| Gene | BST1 |
| Long gene name | bone marrow stromal cell antigen 1 |
| Synonyms | CD157 |
| Synonyms name | NAD(+) nucleosidase ADP-ribosyl cyclase 2 |
| Locus | 4p15, 32 |
| Discovery year | 1994-11-17 |
| GenBank acession | D21878 |
| Entrez gene record | 683 |
| Pubmed identfication | 8202488 |
| RefSeq identity | NM_004334 |
| Classification | CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000097739 |