Name : Recombinant Human CD28, TP44 (C-Fc)
Supplier : NOVO
Price :760
SKU : GEN5427830302
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human CD28 is produced by our Mammalian expression system and the target gene encoding Asn19-Pro152 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 3 kD, 42 |
| UniProt number | P10747 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | TP44 (C-Fc), CD28 |
| Short name | TP44 (C-Fc), Recombinant CD28 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | TP44 (C-fragment c), sapiens CD28 molecule, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD28 and IDBG-643371 and ENSBTAG00000007445 and 281050, CD28 and IDBG-79183 and ENSG00000178562 and 940, Cd28 and IDBG-159608 and ENSMUSG00000026012 and 12487, Cell surfaces, Tp44, identical protein binding, this GO :0001772 and immunological synapse and cellular component this GO :0002020 and protease binding and molecular function this GO :0002863 and positive regulation of inflammatory response to antigenic stimulus and biological process this GO :0005070 and SH3/SH2 adaptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006959 and humoral immune response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009967 and positive regulation of signal transduction and biological process this GO :0015026 and coreceptor activity and molecular function this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042089 and cytokine biosynthetic process and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042802 and identical protein binding and molecular function this GO :0045060 and negative thymic T cell selection and biological process this GO :0045066 and regulatory T cell differentiation and biological process this GO :0045070 and positive regulation of viral genome replication and biological process this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045727 and positive regulation of translation and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048304 and positive regulation of isotype switching to IgG isotypes and biological process this GO :0050690 and regulation of defense response to virus by virus and biological process this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0002020: protease binding, this GO :0002020: protease binding and also this GO :0005070: SH3/SH2 adaptor activity and also this GO :0005515: protein binding and also this GO :0015026: coreceptor activity and also this GO :0042802: identical protein binding, this GO :0005070: SH3/SH2 adaptor activity, this GO :0005515: protein binding, this GO :0015026: coreceptor activity, this GO :0042802: identical protein binding, CD28 molecule |
| Identity | 1653 |
| Gene | CD28 |
| Long gene name | CD28 molecule |
| Synonyms gene name | CD28 antigen (Tp44) |
| Synonyms name | T-cell-specific surface glycoprotein |
| Locus | 2q33, 2 |
| Discovery year | 1988-05-11 |
| GenBank acession | J02988 |
| Entrez gene record | 940 |
| Pubmed identfication | 1355979 |
| RefSeq identity | NM_006139 |
| Classification | CD molecules V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000132878 |