Name : Recombinant Human CD30, TNFRSF8, CD30L Receptor (C-Fc)
Supplier : NOVO
Price :1674
SKU : GEN4403561274
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human TNFRSF8 is produced by our Mammalian expression system and the target gene encoding Phe19-Lys379 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 2 kD, 65 |
| UniProt number | P28908 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mMsodium chloride, pH7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKIEGRDMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD30L Receptor (C-Fc), TNFRSF8, CD30 |
| Short name | CD30L Receptor (C-Fc), TNFRSF8, Recombinant CD30 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD30L Receptor (C-fragment c), member 8, sapiens CD30, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD30 and D1S166E and Ki-1, Plasma membranes, TNFRSF8 and IDBG-632372 and ENSBTAG00000039937 and 614780, TNFRSF8 and IDBG-90058 and ENSG00000120949 and 943, Tnfrsf8 and IDBG-203323 and ENSMUSG00000028602 and 21941, member 8, protein binding, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0042535 and positive regulation of tumor necrosis factor biosynthetic process and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045556 and positive regulation of TRAIL biosynthetic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071260 and cellular response to mechanical stimulus and biological process, this GO :0004888: transmembrane signaling receptor activity, this GO :0004888: transmembrane signaling receptor activity and also this GO :0005031: tumor necrosis factor-activated receptor activity and also this GO :0005515: protein binding, this GO :0005031: tumor necrosis factor-activated receptor activity, this GO :0005515: protein binding, tumor necrosis factor receptor superfamily |
| Identity | 11923 |
| Gene | TNFRSF8 |
| Long gene name | TNF receptor superfamily member 8 |
| Synonyms gene | CD30 D1S166E |
| Synonyms gene name | member 8 , tumor necrosis factor receptor superfamily |
| Synonyms | KI-1 |
| Locus | 1p36, 22 |
| Discovery year | 1992-01-10 |
| GenBank acession | M83554 |
| Entrez gene record | 943 |
| Pubmed identfication | 1330892 1310894 |
| Classification | CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT | OTTHUMG00000001827 |