Name : Recombinant Human CD55, DAF (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN9581814375
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human CD55 is produced by our Mammalian expression system and the target gene encoding Asp35-Ser353 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 36 kD |
| UniProt number | P08174 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | DAF (C-6His), CD55 |
| Short name | DAF (C-6His), Recombinant CD55 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | DAF (C-6His), decay accelerating factor to measure complement (Cromer blood group), sapiens CD55 molecule, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD55 and IDBG-106331 and ENSG00000196352 and 1604, CD55 and IDBG-629269 and ENSBTAG00000006984 and 518609, CR and CROM and DAF and TC, Extracellular, alpha-beta T cell activation and biological process this GO :2000563 and positive regulation of CD4-positive, alpha-beta T cell cytokine production and biological process this GO :0043086 and negative regulation of catalytic activity and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045730 and respiratory burst and biological process this GO :0045916 and negative regulation of complement activation and biological process this GO :0060137 and maternal process involved in parturition and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000516 and positive regulation of CD4-positive, alpha-beta T cell proliferation and biological process, classical pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007283 and spermatogenesis and biological process this GO :0008289 and lipid binding and molecular function this GO :0009615 and response to virus and biological process this GO :0009986 and cell surface and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0030449 and regulation of complement activation and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0031664 and regulation of lipopolysaccharide-mediated signaling pathway and biological process this GO :0035743 and CD4-positive, decay accelerating factor for complement (Cromer blood group), lipid binding, this GO :0001618 and virus receptor activity and molecular function this GO :0004857 and enzyme inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006958 and complement activation, this GO :0001618: virus receptor activity, this GO :0001618: virus receptor activity and also this GO :0004857: enzyme inhibitor activity and also this GO :0005515: protein binding and also this GO :0008289: lipid binding, this GO :0004857: enzyme inhibitor activity, this GO :0005515: protein binding, this GO :0008289: lipid binding, CD55 molecule |
| Identity | 2665 |
| Gene | CD55 |
| Long gene name | CD55 molecule (Cromer blood group) |
| Synonyms gene | DAF |
| Synonyms gene name | Cromer blood group system) CD55 molecule, decay accelerating factor for complement (CD55, decay accelerating factor for complement (Cromer blood group) |
| Synonyms | CR TC CROM |
| Locus | 1q32, 2 |
| Discovery year | 2001-06-22 |
| GenBank acession | BC001288 |
| Entrez gene record | 1604 |
| RefSeq identity | NM_000574 |
| Classification | Sushi domain containing CD molecules Blood group antigens |
| Havana BLAST/BLAT | OTTHUMG00000036255 |
| Locus Specific Databases | Blood Group Antigen Mutation Database CD55base: Mutation registry for Decay-accelerating factor (CD55) deficiency (previously known as DAFbase) LRG_127 |