Name : Recombinant Human CD99 Antigen-Like Protein 2, CD99L2 (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN8283692818
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human CD99 Antigen-Like Protein 2 is produced by our Mammalian expression system and the target gene encoding Asp26-Ala188 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 18, 4 kD |
| UniProt number | Q8TCZ2 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD99L2 (C-6His), CD99 Like Protein 2 |
| Short name | CD99L2 (C-6His), Recombinant CD99 Antigen-Like Protein 2 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD99 molecule molecule-like 2 (C-6His), sapiens CD99 molecule protein-Like Protein 2, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD99 and IDBG-40790 and ENSG00000002586 and 4267, CD99 and IDBG-639094 and ENSBTAG00000008114 and, CD99 molecule-like 2, CD99L2 and IDBG-631883 and ENSBTAG00000047708 and 613644, CD99L2 and IDBG-88792 and ENSG00000102181 and 83692, Cd99l2 and IDBG-150697 and ENSMUSG00000035776 and 171486, Cell surfaces, HBA71 and MIC2 and MIC2X and MIC2Y and MSK5X, Plasma membranes, this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process, this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0030054 and cell junction and cellular component, CD99 molecule |
| Identity | 18237 |
| Gene | CD99L2 |
| Long gene name | CD99 molecule like 2 |
| Synonyms gene | MIC2L1 |
| Synonyms gene name | MIC2 like 1 CD99 antigen-like 2 CD99 molecule-like 2 |
| Synonyms | CD99B |
| Locus | Xq28 |
| Discovery year | 2002-02-28 |
| GenBank acession | BC030536 |
| Entrez gene record | 83692 |
| RefSeq identity | NM_031462 |
| Havana BLAST/BLAT | OTTHUMG00000024247 |
| Locus Specific Databases | Mental Retardation database |