Name : Recombinant Human CLEC10A, CD301 (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN2634494315
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human CLEC10A is produced by our Mammalian expression system and the target gene encoding Gln61-His316 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 29, 8 kD |
| UniProt number | Q8IUN9 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESHVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD301 (C-6His), CLEC10A |
| Short name | CD301 (C-6His), Recombinant CLEC10A |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD301 (C-6His), member A, sapiens C-classification lectin domain family 10, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD301 and CLECSF13 and CLECSF14 and HML and HML2 and MGL, CLEC10A and IDBG-23148 and ENSG00000132514 and 10462, CLEC10A and IDBG-634544 and ENSBTAG00000017895 and 514833, Plasma membranes, carbohydrate binding, member A, this GO :0005886 and plasma membrane and cellular component this GO :0006897 and endocytosis and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0030246 and carbohydrate binding and molecular function this GO :0045087 and innate immune response and biological process, this GO :0030246: carbohydrate binding, this GO :0030246: carbohydrate binding, C-type lectin domain family 10 |
| Identity | 16916 |
| Gene | CLEC10A |
| Long gene name | C-type lectin domain family 10 member A |
| Synonyms gene | CLECSF13 CLECSF14 |
| Synonyms gene name | C-type (calcium dependent, carbohydrate-recognition domain) lectin, member A , superfamily member 14 (macrophage-derived) C-type lectin domain family 10 |
| Synonyms | HML2 HML CD301 |
| Synonyms name | macrophage lectin 2 (calcium dependent) |
| Locus | 17p13, 1 |
| Discovery year | 2003-08-06 |
| GenBank acession | D50532 |
| Entrez gene record | 10462 |
| Pubmed identfication | 8598452 |
| RefSeq identity | NM_006344 |
| Classification | CD molecules C-type lectin domain family |
| Havana BLAST/BLAT | OTTHUMG00000177939 |