Name : Recombinant Human CLEC4E, Mincel (N-Fc)
Supplier : NOVO
Price :146
SKU : GEN1434195937
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human C-Type Lectin Domain Family 4 Member E is produced by our Mammalian expression system and the target gene encoding Arg41-Leu219 is expressed with a Fc tag at the N-terminus |
| Molecular Weight | 3 kD, 47 |
| UniProt number | Q9ULY5 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | Mincel (N-Fc), CLEC4E |
| Short name | Mincel (N-Fc), Recombinant CLEC4E |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | Mincel (N-fragment c), sapiens CLEC4E, recombinant H |
| Alternative technique | rec |
| Identity | 14555 |
| Gene | CLEC4E |
| Long gene name | C-type lectin domain family 4 member E |
| Synonyms gene | CLECSF9 |
| Synonyms gene name | C-type (calcium dependent, carbohydrate-recognition domain) lectin, member E , superfamily member 9 C-type lectin domain family 4 |
| Synonyms | mincle |
| Synonyms name | Macrophage-inducible C-type lectin |
| Locus | 12p13, 31 |
| Discovery year | 2001-02-01 |
| GenBank acession | AB024718 |
| Entrez gene record | 26253 |
| Pubmed identfication | 10528209 |
| RefSeq identity | NM_014358 |
| Classification | C-type lectin domain family |
| Havana BLAST/BLAT | OTTHUMG00000168675 |