Name : Recombinant Human Complement Factor H, CFH (C-6His)
Supplier : NOVO
Price :496
SKU : GEN5227585752
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Complement factor H is produced by our Mammalian expression system and the target gene encoding Glu19-Leu449 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 50 kD |
| UniProt number | P08603-2 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 2 um filtered solution of phosphate buffered saline, 20%Glycerol, 4, 5% Trehalose, Supplied as a 0, pH7 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTLVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CFH (C-6His), Complement Factor H |
| Short name | CFH (C-6His), Recombinant Complement Factor H |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | complement factor H (C-6His), sapiens Complement Factor H, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | AHUS1 and AMBP1 and ARMD4 and ARMS1 and CFHL3 and FH and FHL1 and HF and HF1 and HF2 and HUS, CFH and IDBG-105504 and ENSG00000000971 and 3075, Extracellular, alternative pathway and biological process this GO :0008201 and heparin binding and molecular function this GO :0030449 and regulation of complement activation and biological process this GO :0043395 and heparan sulfate proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0072562 and blood microparticle and cellular component, heparan sulfate proteoglycan binding, this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006956 and complement activation and biological process this GO :0006957 and complement activation, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0008201: heparin binding and also this GO :0043395: heparan sulfate proteoglycan binding, this GO :0008201: heparin binding, this GO :0043395: heparan sulfate proteoglycan binding, complement factor H |
| Identity | 4883 |
| Gene | CFH |
| Long gene name | complement factor H |
| Synonyms gene | HF HF1 HF2 |
| Synonyms gene name | H factor 1 (complement) |
| Synonyms | HUS FHL1 ARMS1 ARMD4 |
| Synonyms name | beta-1H H factor 2 (complement) age-related maculopathy susceptibility 1 |
| Locus | 1q31, 3 |
| Discovery year | 1986-01-01 |
| GenBank acession | Y00716 |
| Entrez gene record | 3075 |
| Pubmed identfication | 2889480 2963625 |
| RefSeq identity | NM_000186 |
| Classification | Sushi domain containing Complement system |
| Havana BLAST/BLAT | OTTHUMG00000035607 |
| Locus Specific Databases | CFHbase: Mutation registry for Factor H deficiency (previously known as HF1base) LRG_47 |