Name : Recombinant Human Creatine Kinase, Muscle, CKMM (C-6His)
Supplier : NOVO
Price :95
SKU : GEN7449042475
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human CKMM is produced by our Mammalian expression system and the target gene encoding Met1-Lys381 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 1 kD, 44 |
| UniProt number | P06732 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 10%Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0, pH7 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CKMM (C-6His), Muscle, Creatine Kinase |
| Short name | CKMM (C-6His), Muscle, Recombinant Creatine Kinase |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CKMM (C-6His), Muscle, sapiens Creatine phosphorylation catalyst, recombinant H |
| Alternative technique | rec |
| Identity | 1994 |
| Gene | CKM |
| Long gene name | M-type , creatine kinase |
| Synonyms gene | CKMM |
| Synonyms gene name | creatine kinase, muscle |
| Locus | 19q13, 32 |
| Discovery year | 2001-06-22 |
| GenBank acession | M14780 |
| Entrez gene record | 1158 |
| Havana BLAST/BLAT | OTTHUMG00000181782 |