Recombinant Human Endoglin, CD105 (N-Trx, 6His)

Recombinant Human Endoglin, CD105 (N-Trx, 6His) size: 500 µg 1613

Price 1613

Size 500 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	6His tag at the N-terminus, Recombinant Human Endoglin is produced by our E, coli expression system and the target gene encoding Glu26-Gln176 is expressed with a Trx
Molecular Weight	33, 6 kD
UniProt number	P17813
State of the product	Liquid
Shipping conditions	Dry Ice/ice packs
Formulation	2 um filtered solution of 20 mM PB，150 mM sodium chloride, 4, Supplied as a 0, pH7
Storage recommendations	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMETVHCDLQPVGPERDEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQ
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	6His), CD105 (N-Trx, Endoglin
Short name	6His), CD105 (N-Trx, Recombinant Endoglin
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	6His), CD105 (N-Trx, sapiens Endoglin, recombinant H
Alternative technique	rec
Identity	3349
Gene	ENG
Long gene name	endoglin
Synonyms gene	ORW1 ORW
Synonyms gene name	Osler-Rendu-Weber syndrome 1
Synonyms	END HHT1 CD105
Locus	9q34, 11
Discovery year	1993-03-03
GenBank acession	AF035753
Entrez gene record	2022
Pubmed identfication	8404038 10548503
Classification	CD molecules
Havana BLAST/BLAT	OTTHUMG00000020723
Locus Specific Databases	Hereditary Hemorrhagic Telangiectasia (HHT) Mutation Database LRG_589

Recombinant Human Endoglin, CD105 (N-Trx, 6His)

Recombinant Human Endoglin, CD105 (N-Trx, 6His) size: 500 µg 1613

Similar products

Subscribe to our Newsletter