Recombinant Human EpCAM, TROP1, CD326 (C-Fc)

Recombinant Human EpCAM, TROP1, CD326 (C-Fc) size: 1 mg 1877

Price 1877

Size 1 mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human EpCAM is produced by our Mammalian expression system and the target gene encoding Gln24-Lys265 is expressed with a Fc tag at the C-terminus
Molecular Weight	5 kD, 54
UniProt number	P16422
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	CD326 (C-Fc), TROP1, EpCAM
Short name	CD326 (C-Fc), TROP1, Recombinant EpCAM
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	CD326 (C-fragment c), TROP1, sapiens epithelial cellular adhesion molecule, recombinant H
Alternative technique	rec
Identity	11529
Gene	EPCAM
Long gene name	epithelial cell adhesion molecule
Synonyms gene	M4S1 MIC18 TACSTD1
Synonyms gene name	antigen identified by monoclonal antibody AUA1 tumor-associated calcium signal transducer 1
Synonyms	Ly74 TROP1 GA733-2 EGP34 EGP40 EGP-2 KSA CD326 Ep-CAM HEA125 KS1/4 MK-1 MH99 MOC31 323/A3 17-1A TACST-1 CO-17A ESA
Locus	2p21
Discovery year	1995-10-02
GenBank acession	M33011
Entrez gene record	4072
Pubmed identfication	8382772 11306819
Classification	CD molecules
Havana BLAST/BLAT	OTTHUMG00000128853
Locus Specific Databases	Colon cancer gene variant databases LRG_215

Recombinant Human EpCAM, TROP1, CD326 (C-Fc)

Recombinant Human EpCAM, TROP1, CD326 (C-Fc) size: 1 mg 1877

Similar products

Subscribe to our Newsletter