Name : Recombinant Human Fc γ RIIIB, FCGR3B, CD16b (C-Fc-6His)
Supplier : NOVO
Price :303
SKU : GEN7173607925
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | 6His tag at the C-terminus, Recombinant Human Fc gamma RIIIB is produced by our Mammalian expression system and the target gene encoding Thr20-Gln208 is expressed with a Fc |
| Molecular Weight | 4 kD, 51 |
| UniProt number | O75015 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD16b (C-Fc-6His), FCGR3B, RIIIB, Fc &gamma |
| Short name | CD16b (C-Fc-6His), FCGR3B, RIIIB, Recombinant Fc &gamma |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | CD16b (C-fragment c-6His), RIIIB, fragment c fragment on Immunoglobulin G, low affinity IIIb, receptor (CD16b), sapiens fragment c &gamma, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD16 and CD16b and FCG3 and FCGR3 and FCR-10 and FCRIII and FCRIIIb, FCGR3B and IDBG-104303 and ENSG00000162747 and 2215, IgG binding, Plasma membranes, low affinity IIIb, receptor (CD16b), this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0019864 and IgG binding and molecular function this GO :0031225 and anchored component of membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0019864: IgG binding, this GO :0019864: IgG binding, Fc fragment of IgG |
| Identity | 3620 |
| Gene | FCGR3B |
| Long gene name | Fc fragment of IgG receptor IIIb |
| Synonyms gene | FCGR3 FCG3 |
| Synonyms gene name | Fc fragment of IgG, low affinity IIIb, low affinity IIIb, receptor (CD16b) , receptor for (CD16) Fc fragment of IgG |
| Synonyms | CD16 CD16b |
| Synonyms name | Fc gamma receptor IIIb |
| Locus | 1q23, 3 |
| Discovery year | 1991-08-21 |
| GenBank acession | J04162 |
| Entrez gene record | 2215 |
| Pubmed identfication | 2139735 |
| RefSeq identity | NM_000570 |
| Classification | CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT | OTTHUMG00000074099 |