Name : Recombinant Human GITR, TNFRSF18, CD357 (C-Fc)
Supplier : NOVO
Price :659
SKU : GEN9370394830
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human GITR is produced by our Mammalian expression system and the target gene encoding Gln26-Gln161 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 2 kD, 41 |
| UniProt number | Q9Y5U5 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD357 (C-Fc), TNFRSF18, GITR |
| Short name | CD357 (C-Fc), TNFRSF18, Recombinant GITR |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD357 (C-fragment c), member 18, sapiens GITR, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | AITR and CD357 and GITR and GITR-D, Extracellular, TNFRSF18 and IDBG-635325 and ENSBTAG00000015632 and 516256, TNFRSF18 and IDBG-84584 and ENSG00000186891 and 8784, Tnfrsf18 and IDBG-208288 and ENSMUSG00000041954 and 21936, member 18, protein binding, this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process, this GO :0005031: tumor necrosis factor-activated receptor activity, this GO :0005031: tumor necrosis factor-activated receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, tumor necrosis factor receptor superfamily |
| Identity | 11914 |
| Gene | TNFRSF18 |
| Long gene name | TNF receptor superfamily member 18 |
| Synonyms gene name | member 18 , tumor necrosis factor receptor superfamily |
| Synonyms | AITR GITR CD357 |
| Locus | 1p36, 33 |
| Discovery year | 1998-12-04 |
| GenBank acession | AF125304 |
| Entrez gene record | 8784 |
| Pubmed identfication | 9177197 10037686 |
| RefSeq identity | NM_004195 |
| Classification | CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT | OTTHUMG00000001414 |