Name : Recombinant Human Hematopoietic Prostaglandin D Synthase, HPGDS, GSTS
Supplier : NOVO
Price :496
SKU : GEN3009605661
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Hematopoietic Prostaglandin D Synthase is produced by our E, coli expression system and the target gene encoding Met1-Leu199 is expressed |
| Molecular Weight | 23, 6 kD |
| UniProt number | O60760 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 200 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | GSTS, HPGDS, Hematopoietic Prostaglandin D Synthase |
| Short name | GSTS, HPGDS, Recombinant Hematopoietic Prostaglandin D Synthase |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | GSTS, hematopoietic prostaglandin D synthase, sapiens Hematopoietic Prostaglandin D Synthase, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Cytoplasm, HPGDS and IDBG-30441 and ENSG00000163106 and 27306, HPGDS and IDBG-641077 and ENSBTAG00000017073 and 100139892, Hpgds and IDBG-153041 and ENSMUSG00000029919 and 54486, protein homodimerization activity, this GO :0000287 and magnesium ion binding and molecular function this GO :0004364 and glutathione transferase activity and molecular function this GO :0004667 and prostaglandin-D synthase activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0006805 and xenobiotic metabolic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007626 and locomotory behavior and biological process this GO :0019369 and arachidonic acid metabolic process and biological process this GO :0019371 and cyclooxygenase pathway and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0044281 and small molecule metabolic process and biological process this GO :1901687 and glutathione derivative biosynthetic process and biological process, this GO :0000287: magnesium ion binding, this GO :0000287: magnesium ion binding and also this GO :0004364: glutathione transferase activity and also this GO :0004667: prostaglandin-D synthase activity and also this GO :0005509: calcium ion binding and also this GO :0005515: protein binding and also this GO :0042803: protein homodimerization activity, this GO :0004364: glutathione transferase activity, this GO :0004667: prostaglandin-D synthase activity, this GO :0005509: calcium ion binding, this GO :0005515: protein binding, this GO :0042803: protein homodimerization activity, hematopoietic prostaglandin D synthase |
| Identity | 17890 |
| Gene | HPGDS |
| Long gene name | hematopoietic prostaglandin D synthase |
| Synonyms | GSTS PGDS H-PGDS PGD2 GSTS1-1 GSTS1 |
| Synonyms name | glutathione S-transferase sigma |
| Locus | 4q22, 3 |
| Discovery year | 2009-07-14 |
| GenBank acession | D82073 |
| Entrez gene record | 27306 |
| Pubmed identfication | 9323136 9353279 11672424 |
| RefSeq identity | NM_014485 |
| Classification | Glutathione S-transferases |
| Havana BLAST/BLAT | OTTHUMG00000130974 |