Name : Recombinant Human IL-22 Receptor Subunit α2, IL-22BP, IL-22RA2 (C-Fc)
Supplier : NOVO
Price :156
SKU : GEN4755905727
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human IL-22 Binding Protein is produced by our Mammalian expression system and the target gene encoding Thr22-Pro231 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 51, 8 kD |
| UniProt number | Q969J5-2 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | IL-22BP, IL-22RA2 (C-Fc), 2, IL-22 Receptor Subunit &alpha |
| Short name | IL-22BP, IL-22RA2 (C-Fc), 2, Recombinant IL-22 Receptor Subunit &alpha |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | Interleukin-22BP, Interleukin-22RA2 (C-fragment c), sapiens Interleukin-22 Receptor functionnal sequence &alpha, 2, recombinant H |
| Alternative technique | rec |
| Identity | 14901 |
| Gene | IL22RA2 |
| Long gene name | interleukin 22 receptor subunit alpha 2 |
| Synonyms gene name | alpha 2 , interleukin 22 receptor |
| Synonyms | CRF2-S1 IL-22BP |
| Locus | 6q23, 3 |
| Discovery year | 2002-12-02 |
| GenBank acession | AY044429 |
| Entrez gene record | 116379 |
| Pubmed identfication | 11481447 11390454 |
| Classification | Interleukin receptors |
| Havana BLAST/BLAT | OTTHUMG00000015655 |