Technique
Supplier
Species
Label
Iso Type
Host
Tissue
Recombinant Human Insulin-Like Growth Factor II, IGF2
Recombinant Human Insulin-Like Growth Factor II, IGF2 size: 50 µg 303
Supplier
NOVO
Price
303
Size
50 µg
Contact us
Ask Component cell markers and DNA bp. markers are genetic markerser genes
or DNA sequenceswith
selection audit
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Insulin-Like Growth Factor II is produced by our E, coli expression system and the target gene encoding Ala25-Glu91 is expressed |
| Molecular Weight | 8, 91 kD |
| UniProt number | P01344 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH ~3, 2 um filtered solution of 5 mM Hac, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MFPAMPLSSLFVNAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | IGF2, Insulin-Like Growth Factor II |
| Short name | IGF2, Recombinant Insulin-Like Growth Factor II |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | insulin-like growth factor 2 (somatomedin A), sapiens Insulin-Like Growth Factor II, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | C11orf43 and IGF-II and PP9974, DNA-templated and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007565 and female pregnancy and biological process this GO :0007596 and blood coagulation and biological process this GO :0007613 and memory and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0009314 and response to radiation and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0030168 and platelet activation and biological process this GO :0030546 and receptor activator activity and molecular function this GO :0031017 and exocrine pancreas development and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0031667 and response to nutrient levels and biological process this GO :0032355 and response to estradiol and biological process this GO :0035094 and response to nicotine and biological process this GO :0038028 and insulin receptor signaling pathway via phosphatidylinositol 3-kinase and biological process this GO :0042060 and wound healing and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042493 and response to drug and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0043539 and protein serine/threonine kinase activator activity and molecular function this GO :0044267 and cellular protein metabolic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0045725 and positive regulation of glycogen biosynthetic process and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046628 and positive regulation of insulin receptor signaling pathway and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0051146 and striated muscle cell differentiation and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071902 and positive regulation of protein serine/threonine kinase activity and biological process this GO :0090031 and positive regulation of steroid hormone biosynthetic process and biological process this GO :2000273 and positive regulation of receptor activity and biological process this GO :2000467 and positive regulation of glycogen (starch) synthase activity and biological process, Extracellular, IGF2 and IDBG-20829 and ENSG00000167244 and 3481, IGF2 and IDBG-645244 and ENSBTAG00000013066 and 281240, Igf2 and IDBG-212623 and ENSMUSG00000048583 and 16002, protein serine/threonine kinase activator activity, this GO :0001501 and skeletal system development and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005158 and insulin receptor binding and molecular function this GO :0005159 and insulin-like growth factor receptor binding and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006349 and regulation of gene expression by genetic imprinting and biological process this GO :0006355 and regulation of transcription, this GO :0005158: insulin receptor binding, this GO :0005158: insulin receptor binding and also this GO :0005159: insulin-like growth factor receptor binding and also this GO :0005179: hormone activity and also this GO :0005515: protein binding and also this GO :0008083: growth factor activity and also this GO :0030546: receptor activator activity and also this GO :0043539: protein serine/threonine kinase activator activity, this GO :0005159: insulin-like growth factor receptor binding, this GO :0005179: hormone activity, this GO :0005515: protein binding, this GO :0008083: growth factor activity, this GO :0030546: receptor activator activity, this GO :0043539: protein serine/threonine kinase activator activity, insulin-like growth factor 2 (somatomedin A) |
| Identity | 5466 |
| Gene | IGF2 |
| Long gene name | insulin like growth factor 2 |
| Synonyms gene | C11orf43 |
| Synonyms gene name | chromosome 11 open reading frame 43 insulin-like growth factor 2 |
| Synonyms | FLJ44734 IGF-II |
| Synonyms name | somatomedin A preptin |
| Locus | 11p15, 5 |
| Discovery year | 2001-06-22 |
| GenBank acession | M29645 AK025719 |
| Entrez gene record | 3481 |
| Pubmed identfication | 2450353 3167054 |
| RefSeq identity | NM_000612 |
| Havana BLAST/BLAT | OTTHUMG00000009395 |
| Locus Specific Databases | LOVD - Leiden Open Variation Database LRG_1031 |
Similar products
- Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1 (4-70)
- Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1 (4-70)
- Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1 (4-70)
- Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1 (4-70)
- Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1
- Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1
- Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1
- Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1
- Recombinant Human Insulin-Like Growth Factor-Binding Protein 4, IGFBP-4 (C-6His)
- Recombinant Human Insulin-Like Growth Factor-Binding Protein 4, IGFBP-4 (C-6His)
- Recombinant Human Insulin-Like Growth Factor-Binding Protein 4, IGFBP-4 (C-6His)
- Recombinant Human Insulin-Like Growth Factor-Binding Protein 4, IGFBP-4 (C-6His)
- Recombinant Human Insulin-Like Growth Factor-Binding Protein 5, IGFBP-5 (C-6His)
- Recombinant Human Insulin-Like Growth Factor-Binding Protein 5, IGFBP-5 (C-6His)
- Recombinant Human Insulin-Like Growth Factor-Binding Protein 5, IGFBP-5 (C-6His)
- Recombinant Human Insulin-Like Growth Factor-Binding Protein 5, IGFBP-5 (C-6His)
- Recombinant Human Insulin-Like Growth Factor II, IGF2
- Recombinant Human Insulin-Like Growth Factor II, IGF2
- Recombinant Human Insulin-Like Growth Factor II, IGF2
- Recombinant Human Insulin-Like Growth Factor II, IGF2
- recombinant Human Insulin-like Growth Factor I
- recombinant HUMAN INSULIN-LIKE GROWTH FACTOR I