Technique
Supplier
Species
Label
Iso Type
Host
Tissue
Recombinant Human Interferon γ Receptor 1, IFNGR1 (C-6His)
Recombinant Human Interferon γ Receptor 1, IFNGR1 (C-6His) size: 500 µg 709
Supplier
NOVO
Price
709
Size
500 µg
Contact us
Ask Component cell markers and DNA bp. markers are genetic markerser genes
or DNA sequenceswith
selection audit
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Interferon gamma receptor 1 is produced by our Mammalian expression system and the target gene encoding Glu18-Ser245 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 28, 7 kD |
| UniProt number | P15260 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | IFNGR1 (C-6His), Receptor 1, Interferon &gamma |
| Short name | IFNGR1 (C-6His), Receptor 1, Recombinant Interferon &gamma |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | Receptor 1, interferon g receptor 1 (C-6His), sapiens Interferon &gamma, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BT, CD119 and IFNGR and IMD27A and IMD27B, IFNGR1 and IDBG-97020 and ENSG00000027697 and 3459, Ifngr1 and IDBG-135936 and ENSMUSG00000020009 and 15979, Plasma membranes, cytokine binding, this GO :0004906 and interferon-gamma receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0009615 and response to virus and biological process this GO :0014069 and postsynaptic density and cellular component this GO :0016020 and membrane and cellular component this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019955 and cytokine binding and molecular function this GO :0030425 and dendrite and cellular component this GO :0031982 and vesicle and cellular component this GO :0045087 and innate immune response and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0060334 and regulation of interferon-gamma-mediated signaling pathway and biological process, this GO :0004906: interferon-gamma receptor activity, this GO :0004906: interferon-gamma receptor activity and also this GO :0005515: protein binding and also this GO :0019955: cytokine binding, this GO :0005515: protein binding, this GO :0019955: cytokine binding, 49564 and IDBG-633678 and ENSBTAG00000012544 and 508619, interferon gamma receptor 1 |
| Identity | 5439 |
| Gene | IFNGR1 |
| Long gene name | interferon gamma receptor 1 |
| Synonyms gene | IFNGR |
| Synonyms | CD119 |
| Locus | 6q23, 3 |
| Discovery year | 1986-01-01 |
| Entrez gene record | 3459 |
| Classification | Interferon receptors CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000015656 |
| Locus Specific Databases | IFNGR1base: Mutation registry for IFN&, #947, 1-receptor deficiency LRG_66 |
Similar products
- Recombinant Human Interferon α2B Variant (Arg46), IFN-α2B
- Recombinant Human Interferon α2B Variant (Arg46), IFN-α2B
- Recombinant Human Interferon α2B Variant (Arg46), IFN-α2B
- Recombinant Human Interferon α2B Variant (Arg46), IFN-α2B
- Recombinant Human Interferon γ, IFN-γ (E. coli)
- Recombinant Human Interferon γ, IFN-γ (E. coli)
- Recombinant Human Interferon γ, IFN-γ (E. coli)
- Recombinant Human Interferon γ, IFN-γ (E. coli)
- Recombinant Human Interferon α2A Variant (Lys46), IFN-α2A
- Recombinant Human Interferon α2A Variant (Lys46), IFN-α2A
- Recombinant Human Interferon α2A Variant (Lys46), IFN-α2A
- Recombinant Human Interferon α2A Variant (Lys46), IFN-α2A
- Recombinant Human Interferon α, β Receptor 1, IFNAR1 (C-6His)
- Recombinant Human Interferon α, β Receptor 1, IFNAR1 (C-6His)
- Recombinant Human Interferon α, β Receptor 1, IFNAR1 (C-6His)
- Recombinant Human Interferon α, β Receptor 1, IFNAR1 (C-6His)
- Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-6His)
- Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-6His)
- Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-6His)
- Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-6His)
- Recombinant Human Interferon α-6, IFNA6 (C-6His)
- Recombinant Human Interferon α-6, IFNA6 (C-6His)
- Recombinant Human Interferon α-6, IFNA6 (C-6His)
- Recombinant Human Interferon α-6, IFNA6 (C-6His)
- Recombinant Human Interferon α-4, IFNA4 (C-6His)
- Recombinant Human Interferon α-4, IFNA4 (C-6His)
- Recombinant Human Interferon α-4, IFNA4 (C-6His)
- Recombinant Human Interferon α-1, 13 (C-6His)
- Recombinant Human Interferon α-1, 13 (C-6His)
- Recombinant Human Interferon α-1, 13 (C-6His)
- Recombinant Human Interferon α-1, 13 (C-6His)
- Recombinant Human Interferon ω-1, IFNW1 (C-6His)
- Recombinant Human Interferon ω-1, IFNW1 (C-6His)
- Recombinant Human Interferon ω-1, IFNW1 (C-6His)
- Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-Fc)
- Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-Fc)
- Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-Fc)
- Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-Fc)
- Recombinant Human Interferon γ, IFN-γ
- Recombinant Human Interferon γ, IFN-γ
- Recombinant Human Interferon γ, IFN-γ
- Recombinant Human Interferon γ, IFN-γ
- Recombinant Human Interferon γ Receptor 1, IFNGR1 (C-6His)
- Recombinant Human Interferon γ Receptor 1, IFNGR1 (C-6His)
- Recombinant Human Interferon γ Receptor 1, IFNGR1 (C-6His)
- Recombinant Human Interferon γ Receptor 1, IFNGR1 (C-6His)