Name : Recombinant Human KIR2DL3, NKAT2, CD158b2 (C-Fc)
Supplier : NOVO
Price :1613
SKU : GEN2354160895
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human KIR2DL3 is produced by our Mammalian expression system and the target gene encoding His22-His245 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 51, 7 kD |
| UniProt number | P43628 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD158b2 (C-Fc), NKAT2, KIR2DL3 |
| Short name | CD158b2 (C-Fc), NKAT2, Recombinant KIR2DL3 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | 3, CD158b2 (C-fragment c), NKAT2, large cytoplasmic tail, sapiens killer cellular immunoglobulin-like receptor, two domains, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | 3, CD158b and CD158B2 and GL183 and KIR-023GB and KIR-K7b and KIR-K7c and KIR2DS5 and KIRCL23 and NKAT and NKAT2 and NKAT2A and NKAT2B and p58, KIR2DL3 and IDBG-409456 and ENSG00000243772 and 3804, Plasma membranes, long cytoplasmic tail, protein binding, this GO :0003823 and antigen binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0050776 and regulation of immune response and biological process, this GO :0003823: antigen binding, this GO :0003823: antigen binding and also this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0004872: receptor activity, this GO :0005515: protein binding, two domains, killer cell immunoglobulin-like receptor |
| Identity | 6331 |
| Gene | KIR2DL3 |
| Long gene name | killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3 |
| Synonyms gene name | 3 , killer cell immunoglobulin-like receptor, long cytoplasmic tail, two domains |
| Synonyms | cl-6 nkat2 nkat2a nkat2b p58 CD158B2 |
| Locus | 19q13, 42 |
| Discovery year | 1997-11-14 |
| GenBank acession | L41268 |
| Entrez gene record | 3804 |
| Pubmed identfication | 7749980 8662091 |
| Classification | Killer cell immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000065887 |
| Locus Specific Databases | IPD-KIR Database |