Name : Recombinant Human KIR2DL4, CD158d, KIR103 (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN7302126856
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human KIR2DL4 is produced by our Mammalian expression system and the target gene encoding Trp22-His242 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 25, 34 kD |
| UniProt number | Q99706 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD158d, KIR103 (C-6His), KIR2DL4 |
| Short name | CD158d, KIR103 (C-6His), Recombinant KIR2DL4 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | 4, CD158d, KIR103 (C-6His), large cytoplasmic tail, sapiens killer cellular immunoglobulin-like receptor, two domains, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | 4, CD158D and G9P and KIR-103AS and KIR103 and KIR103AS, KIR2DL4 and IDBG-69383 and ENSG00000189013 and 3805, Plasma membranes, long cytoplasmic tail, protein binding, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0016020 and membrane and cellular component this GO :0050776 and regulation of immune response and biological process, this GO :0004888: transmembrane signaling receptor activity, this GO :0004888: transmembrane signaling receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, two domains, killer cell immunoglobulin-like receptor |
| Identity | 6332 |
| Gene | KIR2DL4 |
| Long gene name | killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4 |
| Synonyms gene name | 4 , killer cell immunoglobulin-like receptor, long cytoplasmic tail, two domains |
| Synonyms | 103AS 15, 212 CD158D |
| Locus | 19q13, 42 |
| Discovery year | 1997-11-14 |
| GenBank acession | X97229 |
| Entrez gene record | 3805 |
| Pubmed identfication | 8946682 |
| RefSeq identity | NM_002255 |
| Classification | Killer cell immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000065880 |
| Locus Specific Databases | IPD-KIR Database |