Name : Recombinant Human Leukocyte Surface Antigen CD47 (C-Fc-Avi)
Supplier : NOVO
Price :126
SKU : GEN8944998943
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Avi tag at the C-terminus, Recombinant Human Leukocyte Surface Antigen CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a Fc & |
| Molecular Weight | 42, 7 kD |
| UniProt number | Q08722 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | Leukocyte Surface CD47 (C-Fc-Avi) |
| Short name | Recombinant Leukocyte Surface Antigen CD47 (C-Fc-Avi) |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | sapiens Leukocyte Surface protein CD47 molecule (C-fragment c-Avi), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD47 and IDBG-48744 and ENSG00000196776 and 961, CD47 and IDBG-631689 and ENSBTAG00000003585 and 282661, Cd47 and IDBG-165137 and ENSMUSG00000055447 and 16423, IAP and MER6 and OA3, Plasma membranes, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0007596 and blood coagulation and biological process this GO :0008228 and opsonization and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009617 and response to bacterium and biological process this GO :0022409 and positive regulation of cell-cell adhesion and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070053 and thrombospondin receptor activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0070053: thrombospondin receptor activity, this GO :0070053: thrombospondin receptor activity, thrombospondin receptor activity, CD47 molecule |
| Identity | 1682 |
| Gene | CD47 |
| Long gene name | CD47 molecule |
| Synonyms gene | MER6 |
| Synonyms gene name | CD47 antigen (Rh-related antigen, integrin-associated signal transducer) |
| Synonyms | IAP OA3 |
| Synonyms name | antigen identified by monoclonal antibody 1D8 antigenic surface determinant protein OA3 integrin associated protein Rh-related antigen leukocyte surface antigen CD47 CD47 glycoprotein |
| Locus | 3q13, 12 |
| Discovery year | 1994-12-12 |
| Entrez gene record | 961 |
| Pubmed identfication | 8294396 2277087 |
| RefSeq identity | NM_001777 |
| Classification | Immunoglobulin like domain containing CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000044216 |