Name : Recombinant Human LIGHT, HVEM-L, TNFSF14, CD258 (N-6His)
Supplier : NOVO
Price :156
SKU : GEN3410275657
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human LIGHT is produced by our Mammalian expression system and the target gene encoding Leu83-Val240 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 18, 2 kD |
| UniProt number | O43557 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | HHHHHHGLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD258 (N-6His), HVEM-L, TNFSF14, LIGHT |
| Short name | CD258 (N-6His), HVEM-L, TNFSF14, Recombinant LIGHT |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD258 (N-6His), HVEM-L, member 14, sapiens LIGHT, tumor necrosis factor (ligand) superfamily, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BT, CD258 and HVEML and LIGHT and LTg and TR2, Extracellular, TNFSF14 and IDBG-21748 and ENSG00000125735 and 8740, Tnfsf14 and IDBG-193745 and ENSMUSG00000005824 and 50930, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, member 14, this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0008588 and release of cytoplasmic sequestered NF-kappaB and biological process this GO :0010820 and positive regulation of T cell chemotaxis and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043029 and T cell homeostasis and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process, this GO :0005102: receptor binding, this GO :0005102: receptor binding and also this GO :0005125: cytokine activity and also this GO :0005164: tumor necrosis factor receptor binding and also this GO :0005515: protein binding and also this GO :0043027: cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0005125: cytokine activity, this GO :0005164: tumor necrosis factor receptor binding, this GO :0005515: protein binding, this GO :0043027: cysteine-type endopeptidase inhibitor activity involved in apoptotic process, 64160 and IDBG-643941 and ENSBTAG00000012223 and 505521, tumor necrosis factor (ligand) superfamily |
| Identity | 11930 |
| Gene | TNFSF14 |
| Long gene name | tumor necrosis factor superfamily member 14 |
| Synonyms gene name | member 14 , tumor necrosis factor (ligand) superfamily |
| Synonyms | LIGHT LTg HVEM-L CD258 |
| Locus | 19p13, 3 |
| Discovery year | 1998-12-04 |
| GenBank acession | AF036581 |
| Entrez gene record | 8740 |
| Pubmed identfication | 9462508 |
| Classification | Tumor necrosis factor superfamily CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000181835 |