Name : Recombinant Human LILRB5, CD85c, LIR-8 (C-6His)
Supplier : NOVO
Price :1328
SKU : GEN9479976048
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Leukocyte Immunoglobulin-like Receptor Subfamily B Member 5 is produced by our Mammalian expression system and the target gene encoding Gly24-His456 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 47, 8 kD |
| UniProt number | O75023 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | GTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD85c, LIR-8 (C-6His), LILRB5 |
| Short name | CD85c, LIR-8 (C-6His), Recombinant LILRB5 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD85c, LIR-8 (C-6His), member 5, sapiens leukocyte immunoglobulin-like receptor, subfamily B (including TM and ITIM domains), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD85C and LIR-8 and LIR8, LILRB5 and IDBG-68391 and ENSG00000105609 and 10990, Plasma membranes, member 5, protein binding, subfamily B (with TM and ITIM domains), this GO :0002376 and immune system process and biological process this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0006952 and defense response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0016021 and integral component of membrane and cellular component, this GO :0004888: transmembrane signaling receptor activity, this GO :0004888: transmembrane signaling receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, leukocyte immunoglobulin-like receptor |
| Identity | 6609 |
| Gene | LILRB5 |
| Long gene name | leukocyte immunoglobulin like receptor B5 |
| Synonyms gene name | leukocyte immunoglobulin-like receptor, member 5 , subfamily B (with TM and ITIM domains) |
| Synonyms | LIR-8 LIR8 CD85c |
| Synonyms name | leucocyte Ig-like receptor B5 |
| Locus | 19q13, 4 |
| Discovery year | 2000-01-11 |
| GenBank acession | AF025534 |
| Pubmed identfication | 9548455 |
| Classification | Inhibitory leukocyte immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000066636 |