Name : Recombinant Human Limbic System-Associated Membrane Protein, LSAMP (C-6His)
Supplier : NOVO
Price :146
SKU : GEN5555962576
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human LSAMP is produced by our Mammalian expression system and the target gene encoding Val29-Asn315 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 32, 8 kD |
| UniProt number | Q13449 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | LSAMP (C-6His), Limbic Associated Membrane Protein |
| Short name | LSAMP (C-6His), Recombinant Limbic System-Associated Membrane Protein |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | limbic system-associated membrane protein (C-6His), sapiens Limbic System-Associated Membrane Protein, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | IGLON3 and LAMP, LSAMP and IDBG-50984 and ENSG00000185565 and 4045, Lsamp and IDBG-160888 and ENSMUSG00000061080 and 268890, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007399 and nervous system development and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0035641 and locomotory exploration behavior and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding, limbic system-associated membrane protein |
| Identity | 6705 |
| Gene | LSAMP |
| Long gene name | limbic system-associated membrane protein |
| Synonyms | LAMP IGLON3 |
| Synonyms name | IgLON family member 3 |
| Locus | 3q13, 31 |
| Discovery year | 1998-06-16 |
| GenBank acession | U41901 |
| Entrez gene record | 4045 |
| Pubmed identfication | 9615236 |
| RefSeq identity | NM_002338 |
| Classification | I-set domain containing IgLON cell adhesion molecules |
| Havana BLAST/BLAT | OTTHUMG00000159308 |