Name : Recombinant Human Low-Density Lipoprotein Receptor, LDLR (C-6His)
Supplier : NOVO
Price :359
SKU : GEN3656675319
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human LDL Receptor is produced by our Mammalian expression system and the target gene encoding Ala22-Arg788 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 78 kD, 84 |
| UniProt number | P01130 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 50 mM HEPES, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVRLENLYFQGHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | LDLR (C-6His), Lipoprotein Receptor |
| Short name | LDLR (C-6His), Recombinant Low-Density Lipoprotein Receptor |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | low density lipoprotein receptor (C-6His), sapiens Low-Density Lipoprotein Receptor, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Cell surfaces, FH and FHC and LDLCQ2, LDLR and IDBG-28808 and ENSG00000130164 and 3949, LDLR and IDBG-643476 and ENSBTAG00000012314 and 281276, Ldlr and IDBG-141358 and ENSMUSG00000032193 and 16835, this GO :0001523 and retinoid metabolic process and biological process this GO :0001948 and glycoprotein binding and molecular function this GO :0005041 and low-density lipoprotein receptor activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005764 and lysosome and cellular component this GO :0005768 and endosome and cellular component this GO :0005769 and early endosome and cellular component this GO :0005770 and late endosome and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005905 and coated pit and cellular component this GO :0006629 and lipid metabolic process and biological process this GO :0006897 and endocytosis and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0007603 and phototransduction, this GO :0001948: glycoprotein binding, this GO :0001948: glycoprotein binding and also this GO :0005041: low-density lipoprotein receptor activity and also this GO :0005509: calcium ion binding and also this GO :0005515: protein binding and also this GO :0030169: low-density lipoprotein particle binding and also this GO :0030229: very-low-density lipoprotein particle receptor activity, this GO :0005041: low-density lipoprotein receptor activity, this GO :0005509: calcium ion binding, this GO :0005515: protein binding, this GO :0030169: low-density lipoprotein particle binding, this GO :0030229: very-low-density lipoprotein particle receptor activity, very-low-density lipoprotein particle receptor activity, visible light and biological process this GO :0008203 and cholesterol metabolic process and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010008 and endosome membrane and cellular component this GO :0010867 and positive regulation of triglyceride biosynthetic process and biological process this GO :0010899 and regulation of phosphatidylcholine catabolic process and biological process this GO :0015914 and phospholipid transport and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0030169 and low-density lipoprotein particle binding and molecular function this GO :0030229 and very-low-density lipoprotein particle receptor activity and molecular function this GO :0030299 and intestinal cholesterol absorption and biological process this GO :0030301 and cholesterol transport and biological process this GO :0030669 and clathrin-coated endocytic vesicle membrane and cellular component this GO :0034362 and low-density lipoprotein particle and cellular component this GO :0034383 and low-density lipoprotein particle clearance and biological process this GO :0042157 and lipoprotein metabolic process and biological process this GO :0042159 and lipoprotein catabolic process and biological process this GO :0042632 and cholesterol homeostasis and biological process this GO :0043235 and receptor complex and cellular component this GO :0044281 and small molecule metabolic process and biological process this GO :0070508 and cholesterol import and biological process this GO :2000188 and regulation of cholesterol homeostasis and biological process, low density lipoprotein receptor |
| Identity | 6547 |
| Gene | LDLR |
| Long gene name | low density lipoprotein receptor |
| Synonyms | LDLCQ2 |
| Synonyms name | familial hypercholesterolemia |
| Locus | 19p13, 2 |
| Discovery year | 1986-01-01 |
| GenBank acession | AY114155 |
| Entrez gene record | 3949 |
| Classification | Low density lipoprotein receptors |
| Havana BLAST/BLAT | OTTHUMG00000171935 |
| Locus Specific Databases | Familial UMD Locus Specific Databases British Heart Foundation LRG_274 , Hypercholesterolemia |