Name : Recombinant Human Lymphocyte Antigen 6H, LY6H (C-6His)
Supplier : NOVO
Price :496
SKU : GEN3396165331
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 10, 9 kD |
| UniProt number | O94772 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGLDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | LY6H (C-6His), Lymphocyte 6H |
| Short name | LY6H (C-6His), Recombinant Lymphocyte Antigen 6H |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | locus H (C-6His), lymphocyte antigen 6 complex, sapiens Lymphocyte protein 6H, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BT, LY6H and IDBG-38152 and ENSG00000176956 and 4062, Ly6h and IDBG-150907 and ENSMUSG00000022577 and 23934, NMLY6, Plasma membranes, locus H, this GO :0005886 and plasma membrane and cellular component this GO :0007399 and nervous system development and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0031225 and anchored component of membrane and cellular component, 104308 and IDBG-643841 and ENSBTAG00000011939 and 618749, lymphocyte antigen 6 complex |
| Identity | 6728 |
| Gene | LY6H |
| Long gene name | lymphocyte antigen 6 family member H |
| Synonyms gene name | locus H , lymphocyte antigen 6 complex |
| Synonyms | NMLY6 |
| Locus | 8q24, 3 |
| Discovery year | 1998-06-19 |
| GenBank acession | AB012293 |
| Entrez gene record | 4062 |
| Pubmed identfication | 9799603 |
| Classification | LY6/PLAUR domain containing |
| Havana BLAST/BLAT | OTTHUMG00000154890 |