Name : Recombinant Human Mesothelin, MSLN, CAK1, MPF (C-6His)
Supplier : NOVO
Price :1328
SKU : GEN3304144260
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Mesothelin is produced by our Mammalian expression system and the target gene encoding Leu37-Arg286 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 27, 8 kD |
| UniProt number | Q13421 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CAK1, MPF (C-6His), MSLN, Mesothelin |
| Short name | CAK1, MPF (C-6His), MSLN, Recombinant Mesothelin |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CAK1, MPF (C-6His), mesothelin, sapiens Mesothelin, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Extracellular, MPF and SMRP, MSLN and IDBG-634054 and ENSBTAG00000000177 and 516237, MSLN and IDBG-8270 and ENSG00000102854 and 10232, Msln and IDBG-152832 and ENSMUSG00000063011 and 56047, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0031016 and pancreas development and biological process this GO :0031225 and anchored component of membrane and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding, mesothelin |
| Identity | 7371 |
| Gene | MSLN |
| Long gene name | mesothelin |
| Synonyms | CAK1 MPF |
| Locus | 16p13, 3 |
| Discovery year | 1999-11-22 |
| GenBank acession | U40434 |
| Entrez gene record | 10232 |
| Pubmed identfication | 7665620 8552591 |
| Havana BLAST/BLAT | OTTHUMG00000047992 |