Name : Recombinant Human NCR3, NKp30, CD337 (Leu19-Gly135,C-Fc)
Supplier : NOVO
Price :369
SKU : GEN5329247193
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human NCR3 is produced by our Mammalian expression system and the target gene encoding Leu19-Gly135 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 39, 9 kD |
| UniProt number | O14931 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD337 (Leu19-Gly135, NKp30, C-Fc), NCR3 |
| Short name | CD337 (Leu19-Gly135, NKp30, C-Fc), Recombinant NCR3 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD337 (Leu19-Gly135, NKp30, sapiens natural cytotoxicity triggering receptor 3, C-fragment c), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | NCR3 and IDBG-634145 and ENSBTAG00000018343 and 513769, NCR3 and IDBG-78112 and ENSG00000204475 and 259197, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0008037 and cell recognition and biological process this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding, natural cytotoxicity triggering receptor 3 |
| Identity | 19077 |
| Gene | NCR3 |
| Long gene name | natural cytotoxicity triggering receptor 3 |
| Synonyms gene | LY117 |
| Synonyms gene name | lymphocyte antigen 117 |
| Synonyms | 1C7 NKp30 CD337 |
| Locus | 6p21, 33 |
| Discovery year | 2002-08-05 |
| GenBank acession | AB055881 |
| Entrez gene record | 259197 |
| Pubmed identfication | 8824804 11782277 |
| Classification | CD molecules V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000031123 |