Name : Recombinant Human NEDD8-Conjugating Enzyme UBC12, UBE2M
Supplier : NOVO
Price :1014
SKU : GEN9674323221
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate |
| Molecular Weight | 20, 9 kD |
| UniProt number | P61081 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 10%glycerol , 150 mM sodium chloride, 2 mM DTT, 2 um filtered solution of 50 mM HEPES, 5, Supplied as a 0, pH 7 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | UBE2M, NEDD8-Conjugating UBC12 |
| Short name | UBE2M, Recombinant NEDD8-Conjugating Enzyme UBC12 |
| Technique | E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | UBE2M, sapiens NEDD8-Conjugating Enzyme UBC12, recombinant H |
| Alternative technique | rec |
| Identity | 12491 |
| Gene | UBE2M |
| Long gene name | ubiquitin conjugating enzyme E2 M |
| Synonyms gene name | ubiquitin-conjugating enzyme E2M (homologous to yeast UBC12) ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast) ubiquitin-conjugating enzyme E2M |
| Synonyms | hUbc12 UBC12 |
| Locus | 19q13, 43 |
| Discovery year | 1999-01-22 |
| GenBank acession | AB012191 |
| Entrez gene record | 9040 |
| Pubmed identfication | 9694792 |
| RefSeq identity | NM_003969 |
| Classification | Ubiquitin conjugating enzymes E2 |
| Havana BLAST/BLAT | OTTHUMG00000183548 |