Name : Recombinant Human NGFRAP1, BEX3
Supplier : NOVO
Price :2486
SKU : GEN7037854218
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human NGFRAP1 is produced by our Mammalian expression system and the target gene encoding Met1-Pro111 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 40 kD |
| UniProt number | Q00994 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | BEX3, NGFRAP1 |
| Short name | BEX3, Recombinant NGFRAP1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | BEX3, sapiens nerve growth factor receptor (TNFRSF16) associated protein 1, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | NGFRAP1 and IDBG-633850 and ENSBTAG00000006026 and 100034674, NGFRAP1 and IDBG-80577 and ENSG00000166681 and 27018, Ngfrap1 and IDBG-173089 and ENSMUSG00000046432 and 12070, metal ion binding, nuclei, this GO :0005123 and death receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008656 and cysteine-type endopeptidase activator activity involved in apoptotic process and molecular function this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0005123: death receptor binding, this GO :0005123: death receptor binding and also this GO :0005515: protein binding and also this GO :0008656: cysteine-type endopeptidase activator activity involved in apoptotic process and also this GO :0046872: metal ion binding, this GO :0005515: protein binding, this GO :0008656: cysteine-type endopeptidase activator activity involved in apoptotic process, this GO :0046872: metal ion binding, nerve growth factor receptor (TNFRSF16) associated protein 1 |
| Identity | 13388 |
| Gene | BEX3 |
| Long gene name | brain expressed X-linked 3 |
| Synonyms gene | NGFRAP1 |
| Synonyms gene name | nerve growth factor receptor (TNFRSF16) associated protein 1 |
| Synonyms | HGR74 Bex NADE DXS6984E |
| Locus | Xq22, 2 |
| Discovery year | 2001-09-19 |
| GenBank acession | AF187064 |
| Entrez gene record | 27018 |
| Pubmed identfication | 10764727 16221301 2171551 |
| RefSeq identity | NM_014380 |
| Classification | Brain expressed X-linked family |
| Havana BLAST/BLAT | OTTHUMG00000022099 |