Recombinant Human NKG2D Ligand 1, NKG2DL, ULBP1 (C-Fc)

Recombinant Human NKG2D Ligand 1, NKG2DL, ULBP1 (C-Fc) size: 1 mg 1877

Price 1877

Size 1 mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling
Molecular Weight	4 kD, 49
UniProt number	Q9BZM6
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	NKG2DL, ULBP1 (C-Fc), NKG2D Ligand 1
Short name	NKG2DL, ULBP1 (C-Fc), Recombinant NKG2D Ligand 1
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	NKG2DL, UL16 binding protein 1 (C-fragment c), sapiens NKG2D Ligand 1, recombinant H
Alternative technique	rec
Alternative to gene target	Plasma membranes, ULBP1 and IDBG-97845 and ENSG00000111981 and 80329, natural killer cell lectin-like receptor binding, this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0019882 and antigen processing and presentation and biological process this GO :0030101 and natural killer cell activation and biological process this GO :0042267 and natural killer cell mediated cytotoxicity and biological process this GO :0046658 and anchored component of plasma membrane and cellular component this GO :0046703 and natural killer cell lectin-like receptor binding and molecular function this GO :0050776 and regulation of immune response and biological process, this GO :0046703: natural killer cell lectin-like receptor binding, this GO :0046703: natural killer cell lectin-like receptor binding, UL16 binding protein 1
Identity	14893
Gene	ULBP1
Long gene name	UL16 binding protein 1
Synonyms	RAET1I
Locus	6q25, 1
Discovery year	2001-04-27
GenBank acession	AF304377
Entrez gene record	80329
Pubmed identfication	11239445 11827464
Havana BLAST/BLAT	OTTHUMG00000015810

Recombinant Human NKG2D Ligand 1, NKG2DL, ULBP1 (C-Fc)

Recombinant Human NKG2D Ligand 1, NKG2DL, ULBP1 (C-Fc) size: 1 mg 1877

Similar products

Subscribe to our Newsletter