Name : Recombinant Human Oxidized Low-Density Lipoprotein Receptor 1, OLR1 (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN8807954150
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human LOX-1 is produced by our Mammalian expression system and the target gene encoding Ser61-Gln273 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 25, 39 kD |
| UniProt number | P78380 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | OLR1 (C-6His), Oxidized Lipoprotein Receptor 1 |
| Short name | OLR1 (C-6His), Recombinant Oxidized Low-Density Lipoprotein Receptor 1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | oxidized low density lipoprotein (lectin-like) receptor 1 (C-6His), sapiens Oxidized Low-Density Lipoprotein Receptor 1, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CLEC8A and LOX1 and LOXIN and SCARE1 and SLOX1, OLR1 and IDBG-18612 and ENSG00000173391 and 4973, OLR1 and IDBG-639562 and ENSBTAG00000004547 and 281368, Olr1 and IDBG-192019 and ENSMUSG00000030162 and 108078, carbohydrate binding, nuclei, this GO :0005041 and low-density lipoprotein receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0006954 and inflammatory response and biological process this GO :0007159 and leukocyte cell-cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0008015 and blood circulation and biological process this GO :0008219 and cell death and biological process this GO :0016020 and membrane and cellular component this GO :0030246 and carbohydrate binding and molecular function this GO :0042157 and lipoprotein metabolic process and biological process this GO :0042542 and response to hydrogen peroxide and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043235 and receptor complex and cellular component this GO :0045121 and membrane raft and cellular component this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005041: low-density lipoprotein receptor activity, this GO :0005041: low-density lipoprotein receptor activity and also this GO :0005515: protein binding and also this GO :0030246: carbohydrate binding, this GO :0005515: protein binding, this GO :0030246: carbohydrate binding, oxidized low density lipoprotein (lectin-like) receptor 1 |
| Identity | 8133 |
| Gene | OLR1 |
| Long gene name | oxidized low density lipoprotein receptor 1 |
| Synonyms gene name | oxidised low density lipoprotein (lectin-like) receptor 1 |
| Synonyms | LOX-1 SCARE1 CLEC8A |
| Locus | 12p13, 2 |
| Discovery year | 1998-01-16 |
| GenBank acession | D89050 |
| Entrez gene record | 4973 |
| Pubmed identfication | 9763655 |
| RefSeq identity | NM_002543 |
| Classification | Scavenger receptors C-type lectin domain family |
| Havana BLAST/BLAT | OTTHUMG00000168527 |