Name : Recombinant Human Parathyroid Hormone, Parathormone, PTH (1-84)
Supplier : NOVO
Price :1836
SKU : GEN4984696488
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | FSH comprise the , Human recombinant LHRG and GHRH are produced in E, The glands that secrete Luteinizing hormones LHRG and LH, The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine , coli or in yeast cells, Hormone releasing factors and releasing hormones are  , endocrine signaling system, glands , in , intracrine signaling) or nearby cells (paracrine signaling), multicellular organisms, or , produced by , signaling molecules  |
| Molecular Weight | 9 kD |
| UniProt number | P01270 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 5% Mannitol, pH 4, 2 um filtered solution of 10 mM HAc-NaAc, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | PTH (1-84), Parathormone, Parathyroid Hormone |
| Short name | PTH (1-84), Parathormone, Recombinant Parathyroid Hormone |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | Parathormone, parathyroid hormone (1-84), sapiens Parathyroid Hormone, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Extracellular, PTH and IDBG-32891 and ENSG00000152266 and 5741, PTH and IDBG-632953 and ENSBTAG00000019080 and 280903, PTH1, Pth and IDBG-207092 and ENSMUSG00000059077 and 19226, peptide hormone receptor binding, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001501 and skeletal system development and biological process this GO :0003705 and RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007189 and adenylate cyclase-activating G-protein coupled receptor signaling pathway and biological process this GO :0007266 and Rho protein signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008628 and hormone-mediated apoptotic signaling pathway and biological process this GO :0009967 and positive regulation of signal transduction and biological process this GO :0010288 and response to lead ion and biological process this GO :0010468 and regulation of gene expression and biological process this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030819 and positive regulation of cAMP biosynthetic process and biological process this GO :0031667 and response to nutrient levels and biological process this GO :0031856 and parathyroid hormone receptor binding and molecular function this GO :0031857 and type 1 parathyroid hormone receptor binding and molecular function this GO :0033280 and response to vitamin D and biological process this GO :0034645 and cellular macromolecule biosynthetic process and biological process this GO :0042493 and response to drug and biological process this GO :0045453 and bone resorption and biological process this GO :0045471 and response to ethanol and biological process this GO :0045725 and positive regulation of glycogen biosynthetic process and biological process this GO :0045778 and positive regulation of ossification and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046058 and cAMP metabolic process and biological process this GO :0046326 and positive regulation of glucose import and biological process this GO :0046686 and response to cadmium ion and biological process this GO :0051428 and peptide hormone receptor binding and molecular function this GO :0071107 and response to parathyroid hormone and biological process this GO :0071774 and response to fibroblast growth factor and biological process, this GO :0003705: RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity, this GO :0003705: RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity and also this GO :0005179: hormone activity and also this GO :0031856: parathyroid hormone receptor binding and also this GO :0031857: type 1 parathyroid hormone receptor binding and also this GO :0051428: peptide hormone receptor binding, this GO :0005179: hormone activity, this GO :0031856: parathyroid hormone receptor binding, this GO :0031857: type 1 parathyroid hormone receptor binding, this GO :0051428: peptide hormone receptor binding, parathyroid hormone |
| Identity | 9606 |
| Gene | PTH |
| Long gene name | parathyroid hormone |
| Synonyms | PTH1 |
| Synonyms name | parathyrin parathormone parathyroid hormone 1 preproparathyroid hormone prepro-PTH |
| Locus | 11p15, 3 |
| Discovery year | 2001-06-22 |
| GenBank acession | J00301 |
| Entrez gene record | 5741 |
| Pubmed identfication | 1672845 |
| RefSeq identity | NM_000315 |
| Classification | Endogenous ligands |
| Havana BLAST/BLAT | OTTHUMG00000165785 |