Name : Recombinant Human PDCD4, H731 (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN4563871253
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Programmed Cell Death Protein 4 is produced by our E, coli expression system and the target gene encoding Lys212-Pro357 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 17 kD |
| UniProt number | Q53EL6 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | H731 (C-6His), PDCD4 |
| Short name | H731 (C-6His), Recombinant PDCD4 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | H731 (C-6His), sapiens programmed cellular death 4 (neoplastic transformation inhibitor), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | DNA-templated and biological process, PDCD4 and IDBG-639738 and ENSBTAG00000019434 and 506724, PDCD4 and IDBG-89535 and ENSG00000150593 and 100616113, Pdcd4 and IDBG-176913 and ENSMUSG00000024975 and 18569, nuclei, protein binding, this GO :0003723 and RNA binding and molecular function this GO :0005488 and binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007569 and cell aging and biological process this GO :0043508 and negative regulation of JUN kinase activity and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0045892 and negative regulation of transcription, this GO :0003723: RNA binding, this GO :0003723: RNA binding and also this GO :0005488: binding and also this GO :0005515: protein binding, this GO :0005488: binding, this GO :0005515: protein binding, 27250, programmed cell death 4 (neoplastic transformation inhibitor) |
| Identity | 8763 |
| Gene | PDCD4 |
| Long gene name | programmed cell death 4 |
| Synonyms gene name | programmed cell death 4 (neoplastic transformation inhibitor) |
| Synonyms | H731 |
| Synonyms name | nuclear antigen H731 |
| Locus | 10q25, 2 |
| Discovery year | 2000-05-10 |
| GenBank acession | U83908 |
| Entrez gene record | 27250 |
| Pubmed identfication | 9759869 |
| RefSeq identity | NM_014456 |
| Havana BLAST/BLAT | OTTHUMG00000019048 |