Name : Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA
Supplier : NOVO
Price :1014
SKU : GEN2699469516
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A is produced by our E, coli expression system and the target gene encoding Met1-Glu165 is expressed |
| Molecular Weight | 18 kD |
| UniProt number | P62937 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 10%glycerol, pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CYPA, Cyclophilin A, Peptidyl-prolyl Cis-trans Isomerase A |
| Short name | CYPA, Cyclophilin A, Recombinant Peptidyl-prolyl Cis-trans Isomerase A |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CYPA, Cyclophilin A, sapiens Peptidyl-prolyl Cis-trans Isomerase A, recombinant H |
| Alternative technique | rec |
| Identity | 9253 |
| Gene | PPIA |
| Long gene name | peptidylprolyl isomerase A |
| Synonyms | CYPA |
| Synonyms name | cyclophilin A |
| Locus | 7p13 |
| Discovery year | 1991-12-06 |
| GenBank acession | X52851 |
| Entrez gene record | 5478 |
| Pubmed identfication | 1989998 2197089 |
| RefSeq identity | NM_021130 |
| Classification | Cyclophilin peptidylprolyl isomerases |
| Havana BLAST/BLAT | OTTHUMG00000023687 |