Name : Recombinant Human Phosphoserine Phosphatase, PSP (C-6His)
Supplier : NOVO
Price :156
SKU : GEN3148505706
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Phosphoserine Phosphatase is produced by our E, coli expression system and the target gene encoding Met1-Glu225 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 07 kD, 26 |
| UniProt number | P78330 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 250 mM sodium chloride, 50 mM Imidazole, pH 8, 2 um filtered solution of 50 mM Tris, 5 , Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEELEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | PSP (C-6His), Phosphoserine Phosphatase |
| Short name | PSP (C-6His), Recombinant Phosphoserine Phosphatase |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | PSP (C-6His), sapiens Phosphoserine Phosphatase, recombinant H |
| Alternative technique | rec |
| Identity | 9577 |
| Gene | PSPH |
| Long gene name | phosphoserine phosphatase |
| Synonyms gene | PSP |
| Locus | 7p11, 2 |
| Discovery year | 2001-06-22 |
| GenBank acession | Y10275 |
| Entrez gene record | 5723 |
| Pubmed identfication | 6297854 9188776 |
| RefSeq identity | NM_004577 |
| Classification | HAD Asp-based non-protein phosphatases |
| Havana BLAST/BLAT | OTTHUMG00000023441 |