Name : Recombinant Human Regenerating Islet-Derived Protein 3-γ, Reg3γ, REG3G (C-6His)
Supplier : NOVO
Price :202
SKU : GEN3855081349
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Regenerating islet-derived protein 3-gamma is produced by our Mammalian expression system and the target gene encoding Glu27-Asp175 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 17, 5 kD |
| UniProt number | Q6UW15 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKDVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | REG3G (C-6His), Reg3&gamma, Regenerating Islet-Derived Protein 3-&gamma |
| Short name | REG3G (C-6His), Reg3&gamma, Recombinant Regenerating Islet-Derived Protein 3-&gamma |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | Reg3&gamma, regenerating islet-derived 3 g (C-6His), sapiens Regenerating Islet-Derived Protein 3-&gamma, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Extracellular, REG3G and IDBG-58387 and ENSG00000143954 and 130120, carbohydrate binding, this GO :0002755 and MyD88-dependent toll-like receptor signaling pathway and biological process this GO :0005576 and extracellular region and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006953 and acute-phase response and biological process this GO :0010838 and positive regulation of keratinocyte proliferation and biological process this GO :0030246 and carbohydrate binding and molecular function this GO :0045617 and negative regulation of keratinocyte differentiation and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0090303 and positive regulation of wound healing and biological process, this GO :0030246: carbohydrate binding, this GO :0030246: carbohydrate binding, regenerating islet-derived 3 gamma |
| Identity | 29595 |
| Gene | REG3G |
| Long gene name | regenerating family member 3 gamma |
| Synonyms gene name | regenerating islet-derived 3 gamma |
| Synonyms | UNQ429 LPPM429 PAP1B |
| Locus | 2p12 |
| Discovery year | 2005-02-11 |
| GenBank acession | AY359047 |
| Entrez gene record | 130120 |
| Pubmed identfication | 12975309 |
| RefSeq identity | NM_198448 |
| Classification | C-type lectin domain containing |
| Havana BLAST/BLAT | OTTHUMG00000130018 |