Name : Recombinant Human Resistin, RETN, ADSF (C-6His)
Supplier : NOVO
Price :146
SKU : GEN9054467682
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Resistin is produced by our E, coli expression system and the target gene encoding Lys19-Pro108 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 10, 6 kD |
| UniProt number | Q9HD89 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of 20 mM Acetic acid, Lyophilized from a 0, pH 3 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | ADSF (C-6His), RETN, Resistin |
| Short name | ADSF (C-6His), RETN, Recombinant Resistin |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | ADSF (C-6His), resistin, sapiens Resistin, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | RETN and IDBG-23228 and ENSG00000104918 and 56729, RETN and IDBG-643684 and ENSBTAG00000004716 and 369020, Retn and IDBG-130350 and ENSMUSG00000012705 and 57264, hormone activity, nuclei, this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0007568 and aging and biological process this GO :0008150 and biological process and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010714 and positive regulation of collagen metabolic process and biological process this GO :0014911 and positive regulation of smooth muscle cell migration and biological process this GO :0032868 and response to insulin and biological process this GO :0045444 and fat cell differentiation and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000252 and negative regulation of feeding behavior and biological process this GO :2000872 and positive regulation of progesterone secretion and biological process, this GO :0005179: hormone activity, this GO :0005179: hormone activity, resistin |
| Identity | 20389 |
| Gene | RETN |
| Long gene name | resistin |
| Synonyms | FIZZ3 ADSF RETN1 |
| Locus | 19p13, 2 |
| Discovery year | 2003-02-03 |
| GenBank acession | AF205952 |
| Entrez gene record | 56729 |
| Pubmed identfication | 12050208 |
| RefSeq identity | NM_020415 |
| Havana BLAST/BLAT | OTTHUMG00000182503 |