Name : Recombinant Human S100A7
Supplier : NOVO
Price :1328
SKU : GEN8820902713
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human S100A7 is produced by our E, coli expression system and the target gene encoding Met1-Gln101 is expressed |
| Molecular Weight | 11, 5 kD |
| UniProt number | P31151 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, -20°, Aliquots of reconstituted samples are stable at <, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 4 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | S100A7 |
| Short name | Recombinant S100A7 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | sapiens S100 calcium binding protein A7, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | PSOR1 and S100A7c, RAGE receptor binding, S100A7 and IDBG-102676 and ENSG00000143556 and 6278, nuclei, this GO :0000302 and response to reactive oxygen species and biological process this GO :0001525 and angiogenesis and biological process this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005829 and cytosol and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0008270 and zinc ion binding and molecular function this GO :0008544 and epidermis development and biological process this GO :0010820 and positive regulation of T cell chemotaxis and biological process this GO :0030216 and keratinocyte differentiation and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0045087 and innate immune response and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050829 and defense response to Gram-negative bacterium and biological process this GO :0051238 and sequestering of metal ion and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071624 and positive regulation of granulocyte chemotaxis and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process, this GO :0005509: calcium ion binding, this GO :0005509: calcium ion binding and also this GO :0005515: protein binding and also this GO :0008270: zinc ion binding and also this GO :0050786: RAGE receptor binding, this GO :0005515: protein binding, this GO :0008270: zinc ion binding, this GO :0050786: RAGE receptor binding, S100 calcium binding protein A7 |
| Identity | 10497 |
| Gene | S100A7 |
| Long gene name | S100 calcium binding protein A7 |
| Synonyms gene | PSOR1 |
| Synonyms gene name | S100 calcium-binding protein A7 (psoriasin 1) S100 calcium binding protein A7 (psoriasin 1) |
| Synonyms | S100A7c |
| Locus | 1q21, 3 |
| Discovery year | 1992-10-08 |
| GenBank acession | BC034687 |
| Entrez gene record | 6278 |
| Pubmed identfication | 1940442 |
| RefSeq identity | NM_002963 |
| Classification | S100 calcium binding proteins EF-hand domain containing |
| Havana BLAST/BLAT | OTTHUMG00000013123 |