Name : Recombinant Human Serum Amyloid A1, SAA1 (N-6His)
Supplier : NOVO
Price :202
SKU : GEN8340248607
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Serum Amyloid A1 Protein is produced by our E, coli expression system and the target gene encoding Arg19-Tyr122 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 13, 2 kD |
| UniProt number | P0DJI8 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 8, 1 mM EDTA, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | Sera, recombinants |
| Gene target | SAA1 (N-6His), Amyloid A1 |
| Short name | SAA1 (N-6His), Recombinant Serum Amyloid A1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | sapiens blood serum Amyloid A1, serum amyloid A1 (N-6His), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Extracellular, PIG4 and SAA and SAA2 and TP53I4, SAA1 and IDBG-34659 and ENSG00000173432 and 6288, heparin binding, this GO :0001664 and G-protein coupled receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0006953 and acute-phase response and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0008201 and heparin binding and molecular function this GO :0030168 and platelet activation and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0034364 and high-density lipoprotein particle and cellular component this GO :0045087 and innate immune response and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0048246 and macrophage chemotaxis and biological process this GO :0048247 and lymphocyte chemotaxis and biological process this GO :0050708 and regulation of protein secretion and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0050716 and positive regulation of interleukin-1 secretion and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071682 and endocytic vesicle lumen and cellular component, this GO :0001664: G-protein coupled receptor binding, this GO :0001664: G-protein coupled receptor binding and also this GO :0008201: heparin binding, this GO :0008201: heparin binding, serum amyloid A1 |
| Identity | 10513 |
| Gene | SAA1 |
| Long gene name | serum amyloid A1 |
| Synonyms gene | SAA |
| Synonyms | PIG4 TP53I4 |
| Locus | 11p15, 1 |
| Discovery year | 1988-01-18 |
| GenBank acession | M10906 |
| Entrez gene record | 6288 |
| Pubmed identfication | 2595451 9305847 |
| RefSeq identity | NM_199161 |
| Classification | Endogenous ligands |
| Havana BLAST/BLAT | OTTHUMG00000166147 |