Filters

Recombinant Human Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-Fc-6His)

Recombinant Human Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-Fc-6His) size: 500 µg 1613

Supplier NOVO
Price 1613
Size 500 µg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
Reacts withHuman
Source proteins, Recombinants or rec
Description 6His tag at the C-terminus, Recombinant Human Sialic Acid Binding Ig-like Lectin 3 is produced by our Mammalian expression system and the target gene encoding Asp18-His259 is expressed with a Fc
Molecular Weight01 kD, 55
UniProt numberP20138
State of the productFreeze-dried
Shipping conditionsAmbient temperature
Formulation 150 mM sodium chloride, 2 mM EDTA, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acidDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHTSDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDHHHHHH
Levels of endotoxin11 IEU/ug, LAL test shows less than than 0
Properties Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Grouprecombinants
Gene target CD33 (C-Fc-6His), Siglec-3, Sialic Acid Binding Ig-Like Lectin 3
Short name CD33 (C-Fc-6His), Siglec-3, Recombinant Sialic Acid Binding Ig-Like Lectin 3
Technique E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species Humans, Human
Alternative name CD33 molecule (C-fragment c-6His), Siglec-3, sapiens Sialic Acid Binding Ig-Like Lectin 3, recombinant H
Alternative techniquerec
Alternative to gene target CD33 and IDBG-65737 and ENSG00000105383 and 945, Cell surfaces, p67 and SIGLEC-3 and SIGLEC3, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, CD33 molecule
Identity 1659
Gene CD33
Long gene name CD33 molecule
Synonyms gene name CD33 antigen (gp67)
Synonyms SIGLEC3 SIGLEC-3 p67 FLJ00391
Synonyms name sialic acid binding Ig-like lectin 3
Locus 19q13, 41
Discovery year 1986-01-01
GenBank acession M23197
Entrez gene record 945
Pubmed identfication 3139766 9465907
RefSeq identity NM_001772
Classification CD molecules Sialic acid binding Ig like lectins V-set domain containing
Havana BLAST/BLAT OTTHUMG00000182891

Similar products

Subscribe to our Newsletter