| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human STAT5B is produced by our E, coli expression system and the target gene encoding Met1-Thr321 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 38, 4 kD |
| UniProt number | P51692 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 1 mM DTT, 50% Glycerol, pH 7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | STAT5B (C-6His), Signal Transducer Activator of Transcription 5B |
| Short name | STAT5B (C-6His), Recombinant Signal Transducer Activator of Transcription 5B |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | sapiens Signal Transducer and Activator on Transcription 5B, signal transducer and activator on transcription 5B (C-6His), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006549 and isoleucine metabolic process and biological process this GO :0006573 and valine metabolic process and biological process this GO :0006600 and creatine metabolic process and biological process this GO :0006631 and fatty acid metabolic process and biological process this GO :0006953 and acute-phase response and biological process this GO :0007165 and signal transduction and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0007548 and sex differentiation and biological process this GO :0007565 and female pregnancy and biological process this GO :0007595 and lactation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0019218 and regulation of steroid metabolic process and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019530 and taurine metabolic process and biological process this GO :0019903 and protein phosphatase binding and molecular function this GO :0019915 and lipid storage and biological process this GO :0030155 and regulation of cell adhesion and biological process this GO :0030856 and regulation of epithelial cell differentiation and biological process this GO :0032355 and response to estradiol and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032819 and positive regulation of natural killer cell proliferation and biological process this GO :0032825 and positive regulation of natural killer cell differentiation and biological process this GO :0032870 and cellular response to hormone stimulus and biological process this GO :0033077 and T cell differentiation in thymus and biological process this GO :0035259 and glucocorticoid receptor binding and molecular function this GO :0038161 and prolactin signaling pathway and biological process this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042448 and progesterone metabolic process and biological process this GO :0043029 and T cell homeostasis and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045579 and positive regulation of B cell differentiation and biological process this GO :0045588 and positive regulation of gamma-delta T cell differentiation and biological process this GO :0045621 and positive regulation of lymphocyte differentiation and biological process this GO :0045647 and negative regulation of erythrocyte differentiation and biological process this GO :0045931 and positive regulation of mitotic cell cycle and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process this GO :0046449 and creatinine metabolic process and biological process this GO :0046543 and development of secondary female sexual characteristics and biological process this GO :0046544 and development of secondary male sexual characteristics and biological process this GO :0046983 and protein dimerization activity and molecular function this GO :0048541 and Peyer's patch development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0051272 and positive regulation of cellular component movement and biological process this GO :0060397 and JAK-STAT cascade involved in growth hormone signaling pathway and biological process this GO :0070669 and response to interleukin-2 and biological process this GO :0070670 and response to interleukin-4 and biological process this GO :0070672 and response to interleukin-15 and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0071364 and cellular response to epidermal growth factor stimulus and biological process, STAT5, STAT5B and IDBG-50532 and ENSG00000173757 and 102723386, STAT5B and IDBG-640180 and ENSBTAG00000010125 and 282376, Stat5b and IDBG-211594 and ENSMUSG00000020919 and 20851, nuclei, protein dimerization activity, this GO :0000255 and allantoin metabolic process and biological process this GO :0000979 and RNA polymerase II core promoter sequence-specific DNA binding and molecular function this GO :0001553 and luteinization and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001779 and natural killer cell differentiation and biological process this GO :0001889 and liver development and biological process this GO :0003677 and DNA binding and molecular function this GO :0003682 and chromatin binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0004871 and signal transducer activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006101 and citrate metabolic process and biological process this GO :0006103 and 2-oxoglutarate metabolic process and biological process this GO :0006105 and succinate metabolic process and biological process this GO :0006107 and oxaloacetate metabolic process and biological process this GO :0006355 and regulation of transcription, this GO :0000979: RNA polymerase II core promoter sequence-specific DNA binding, this GO :0000979: RNA polymerase II core promoter sequence-specific DNA binding and also this GO :0003677: DNA binding and also this GO :0003682: chromatin binding and also this GO :0003690: double-stranded DNA binding and also this GO :0003700: sequence-specific DNA binding transcription factor activity and also this GO :0004871: signal transducer activity and also this GO :0005509: calcium ion binding and also this GO :0005515: protein binding and also this GO :0019903: protein phosphatase binding and also this GO :0035259: glucocorticoid receptor binding and also this GO :0043565: sequence-specific DNA binding and also this GO :0046983: protein dimerization activity, this GO :0003677: DNA binding, this GO :0003682: chromatin binding, this GO :0003690: double-stranded DNA binding, this GO :0003700: sequence-specific DNA binding transcription factor activity, this GO :0004871: signal transducer activity, this GO :0005509: calcium ion binding, this GO :0005515: protein binding, this GO :0019903: protein phosphatase binding, this GO :0035259: glucocorticoid receptor binding, this GO :0043565: sequence-specific DNA binding, this GO :0046983: protein dimerization activity, 6777, 789476, signal transducer and activator of transcription 5B |
| Identity | 11367 |
| Gene | STAT5B |
| Long gene name | signal transducer and activator of transcription 5B |
| Locus | 17q21, 2 |
| Discovery year | 1997-01-28 |
| GenBank acession | BC065227 |
| Entrez gene record | 6777 |
| Pubmed identfication | 8631883 |
| RefSeq identity | NM_012448 |
| Classification | SH2 domain containing |
| Havana BLAST/BLAT | OTTHUMG00000150724 |
| Locus Specific Databases | STAT5Bbase: Mutation registry for Growth hormone insensitivity with immunodeficiency LOVD - Leiden Open Variation Database LRG_192 |