Name : Recombinant Human TMIGD2, IGPR-1, CD28H (C-6His)
Supplier : NOVO
Price :2486
SKU : GEN5523306683
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human TMIGD2 is produced by our Mammalian expression system and the target gene encoding Leu23-Gly150 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 17, 3 kD |
| UniProt number | Q96BF3 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD28H (C-6His), IGPR-1, TMIGD2 |
| Short name | CD28H (C-6His), IGPR-1, Recombinant TMIGD2 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD28H (C-6His), IGPR-1, sapiens transmembrane and immunoglobulin domain containing 2, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Plasma membranes, TMIGD2 and IDBG-18672 and ENSG00000167664 and 126259, TMIGD2 and IDBG-644290 and ENSBTAG00000004936 and 524354, coreceptor activity, this GO :0001819 and positive regulation of cytokine production and biological process this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0015026: coreceptor activity, this GO :0015026: coreceptor activity, transmembrane and immunoglobulin domain containing 2 |
| Identity | 28324 |
| Gene | TMIGD2 |
| Long gene name | transmembrane and immunoglobulin domain containing 2 |
| Synonyms | MGC23244 CD28H IGPR-1 |
| Synonyms name | CD28 homologue immunoglobulin-containing and proline-rich receptor-1 |
| Locus | 19p13, 3 |
| Discovery year | 2006-07-05 |
| GenBank acession | BC015655 |
| Entrez gene record | 126259 |
| Pubmed identfication | 22419821 23784006 |
| RefSeq identity | NM_144615 |
| Classification | Immunoglobulin like domain containing |
| Havana BLAST/BLAT | OTTHUMG00000181880 |