| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human/Mouse Transforming Growth Factor beta 3 is produced by our Mammalian expression system and the target gene encoding Ala301-Ser412(Tyr340Phe) is expressed |
| Molecular Weight | 12, 7 kD |
| UniProt number | P10600 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of 4 mM HCl, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | TGFB3, -3, Transforming Growth Factor &beta |
| Short name | TGFB3, -3, Recombinant Transforming Growth Factor &beta |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | b 3, sapiens Transforming Growth Factor &beta, transforming growth factor, -3, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | ARVD and ARVD1 and RNHF and TGF-beta3, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048286 and lung alveolus development and biological process this GO :0048565 and digestive tract development and biological process this GO :0048702 and embryonic neurocranium morphogenesis and biological process this GO :0048839 and inner ear development and biological process this GO :0050431 and transforming growth factor beta binding and molecular function this GO :0050714 and positive regulation of protein secretion and biological process this GO :0051491 and positive regulation of filopodium assembly and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0060021 and palate development and biological process this GO :0060325 and face morphogenesis and biological process this GO :0060364 and frontal suture morphogenesis and biological process this GO :0060391 and positive regulation of SMAD protein import into nucleus and biological process this GO :0070483 and detection of hypoxia and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process, TGFB3 and IDBG-13145 and ENSG00000119699 and 7043, TGFB3 and IDBG-646881 and ENSBTAG00000012004 and 538957, Tgfb3 and IDBG-159061 and ENSMUSG00000021253 and 21809, beta 3, nuclei, this GO :0000187 and activation of MAPK activity and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005114 and type II transforming growth factor beta receptor binding and molecular function this GO :0005160 and transforming growth factor beta receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007184 and SMAD protein import into nucleus and biological process this GO :0007435 and salivary gland morphogenesis and biological process this GO :0007565 and female pregnancy and biological process this GO :0007568 and aging and biological process this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008156 and negative regulation of DNA replication and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009986 and cell surface and cellular component this GO :0010718 and positive regulation of epithelial to mesenchymal transition and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0010936 and negative regulation of macrophage cytokine production and biological process this GO :0016049 and cell growth and biological process this GO :0022601 and menstrual cycle phase and biological process this GO :0030141 and secretory granule and cellular component this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030315 and T-tubule and cellular component this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0030879 and mammary gland development and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0032570 and response to progesterone and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0034616 and response to laminar fluid shear stress and biological process this GO :0034713 and type I transforming growth factor beta receptor binding and molecular function this GO :0040007 and growth and biological process this GO :0042060 and wound healing and biological process this GO :0042476 and odontogenesis and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043025 and neuronal cell body and cellular component this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0043627 and response to estrogen and biological process this GO :0043932 and ossification involved in bone remodeling and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0045893 and positive regulation of transcription, this GO :0005114: type II transforming growth factor beta receptor binding, this GO :0005114: type II transforming growth factor beta receptor binding and also this GO :0005160: transforming growth factor beta receptor binding and also this GO :0005515: protein binding and also this GO :0008083: growth factor activity and also this GO :0034713: type I transforming growth factor beta receptor binding and also this GO :0042802: identical protein binding and also this GO :0046982: protein heterodimerization activity and also this GO :0050431: transforming growth factor beta binding, this GO :0005160: transforming growth factor beta receptor binding, this GO :0005515: protein binding, this GO :0008083: growth factor activity, this GO :0034713: type I transforming growth factor beta receptor binding, this GO :0042802: identical protein binding, this GO :0046982: protein heterodimerization activity, this GO :0050431: transforming growth factor beta binding, transforming growth factor beta binding, transforming growth factor |
| Identity | 11769 |
| Gene | TGFB3 |
| Long gene name | transforming growth factor beta 3 |
| Synonyms gene | ARVD1 ARVD |
| Synonyms gene name | arrhythmogenic right ventricular dysplasia 1 transforming growth factor, beta 3 |
| Synonyms name | prepro-transforming growth factor beta-3 |
| Locus | 14q24 |
| Discovery year | 1989-05-10 |
| Entrez gene record | 7043 |
| Pubmed identfication | 16549496 15639475 |
| RefSeq identity | NM_003239 |
| Classification | Endogenous ligands |
| Havana BLAST/BLAT | OTTHUMG00000171489 |
| Locus Specific Databases | ARVD/C Genetic Variants Database LRG_399 |