Name : Recombinant Human TREML1, TLT-1 (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN2349763563
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human TREML1 is produced by our Mammalian expression system and the target gene encoding Gln16-Pro162 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 16, 88 kD |
| UniProt number | Q86YW5 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | TLT-1 (C-6His), TREML1 |
| Short name | TLT-1 (C-6His), Recombinant TREML1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | TLT-1 (C-6His), sapiens triggering receptor expressed on myeloid cells-like 1, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Cell surfaces, TREML1 and IDBG-630847 and ENSBTAG00000006485 and 784711, TREML1 and IDBG-86561 and ENSG00000161911 and 340205, Treml1 and IDBG-189902 and ENSMUSG00000023993 and 71326, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019722 and calcium-mediated signaling and biological process this GO :0030168 and platelet activation and biological process this GO :0031091 and platelet alpha granule and cellular component this GO :0045087 and innate immune response and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding, triggering receptor expressed on myeloid cells-like 1 |
| Identity | 20434 |
| Gene | TREML1 |
| Long gene name | triggering receptor expressed on myeloid cells like 1 |
| Synonyms gene name | triggering receptor expressed on myeloid cells-like 1 |
| Synonyms | TLT1 dJ238O23, 3 |
| Synonyms name | TREM-like transcript 1 |
| Locus | 6p21, 1 |
| Discovery year | 2003-07-08 |
| GenBank acession | AF534822 |
| Entrez gene record | 340205 |
| Pubmed identfication | 12393607 12645956 |
| RefSeq identity | NM_178174 |
| Classification | V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000016231 |