Recombinant Human TWSG1, TSG (C-6His)

Recombinant Human TWSG1, TSG (C-6His) size: 1 mg 2283

Price 2283

Size 1 mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human TWSG1 is produced by our Mammalian expression system and the target gene encoding Cys26-Phe223 is expressed with a 6His tag at the C-terminus
Molecular Weight	18 kD, 23
UniProt number	Q9GZX9
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMFVDHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene target	TSG (C-6His), TWSG1
Short name	TSG (C-6His), Recombinant TWSG1
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	TSG (C-6His), sapiens TWSG1, recombinant H
Alternative technique	rec
Identity	12429
Gene	TWSG1
Long gene name	twisted gastrulation BMP signaling modulator 1
Synonyms gene name	twisted gastrulation homolog 1 (Drosophila)
Synonyms	TSG
Locus	18p11, 22
Discovery year	2000-02-16
GenBank acession	AA486291
Entrez gene record	57045
Pubmed identfication	11260715
Havana BLAST/BLAT	OTTHUMG00000131597

Recombinant Human TWSG1, TSG (C-6His)

Recombinant Human TWSG1, TSG (C-6His) size: 1 mg 2283

Similar products

Subscribe to our Newsletter