Name : Recombinant Human Urokinase-Type Plasminogen Activator, uPA, PLAU (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN1177047453
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Urokinase is produced by our Mammalian expression system and the target gene encoding Ser21-Leu431 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 41 kD, 47 |
| UniProt number | P00749 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 10% Glycerol, 150 mM sodium chloride, 2 mM CaCl, pH 7, 2 um filtered solution of 20 mM HEPES, 5, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLALVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | PLAU (C-6His), uPA, Urokinase Plasminogen Activator |
| Short name | PLAU (C-6His), uPA, Recombinant Urokinase- Plasminogen Activator |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | plasminogen activator, sapiens Urokinase-classification Plasminogen Activator, uPA, urokinase (C-6His), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | ATF and BDPLT5 and QPD and u-PA and UPA and URK, Extracellular, PLAU and IDBG-630603 and ENSBTAG00000005947 and 281408, PLAU and IDBG-78889 and ENSG00000122861 and 5328, Plau and IDBG-136606 and ENSMUSG00000021822 and 18792, protein binding, this GO :0001666 and response to hypoxia and biological process this GO :0003824 and catalytic activity and molecular function this GO :0004252 and serine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0006935 and chemotaxis and biological process this GO :0007165 and signal transduction and biological process this GO :0007596 and blood coagulation and biological process this GO :0009986 and cell surface and cellular component this GO :0010469 and regulation of receptor activity and biological process this GO :0014909 and smooth muscle cell migration and biological process this GO :0014910 and regulation of smooth muscle cell migration and biological process this GO :0033628 and regulation of cell adhesion mediated by integrin and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042730 and fibrinolysis and biological process this GO :0061041 and regulation of wound healing and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000097 and regulation of smooth muscle cell-matrix adhesion and biological process, this GO :0003824: catalytic activity, this GO :0003824: catalytic activity and also this GO :0004252: serine-type endopeptidase activity and also this GO :0005515: protein binding, this GO :0004252: serine-type endopeptidase activity, this GO :0005515: protein binding, urokinase, plasminogen activator |
| Identity | 9052 |
| Gene | PLAU |
| Long gene name | plasminogen activator, urokinase |
| Synonyms | URK UPA |
| Locus | 10q22, 2 |
| Discovery year | 2001-06-22 |
| GenBank acession | BC013575 |
| Entrez gene record | 5328 |
| Pubmed identfication | 2415429 |
| RefSeq identity | NM_002658 |
| Havana BLAST/BLAT | OTTHUMG00000018494 |
| Locus Specific Databases | LRG_593 |