Name : Recombinant Human V-Set and Ig Domain-Containing Protein 2, VSIG2 (C-6His)
Supplier : NOVO
Price :131
SKU : GEN1216012012
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human VSIG2 is produced by our Mammalian expression system and the target gene encoding Val24-Ala243 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 2 kD, 24 |
| UniProt number | Q96IQ7 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | VSIG2 (C-6His), V-Set Ig Domain Protein 2 |
| Short name | VSIG2 (C-6His), Recombinant V-Set Ig Domain- Protein 2 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | V-set and immunoglobulin domain containing 2 (C-6His), sapiens V-Set and Ig Domain-Containing Protein 2, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | 2210413P10Rik and CTH and CTXL, Plasma membranes, VSIG2 and IDBG-642611 and ENSBTAG00000022379 and 616943, VSIG2 and IDBG-75251 and ENSG00000019102 and 23584, Vsig2 and IDBG-150444 and ENSMUSG00000001943 and 57276, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0016020 and membrane and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding, V-set and immunoglobulin domain containing 2 |
| Identity | 17149 |
| Gene | VSIG2 |
| Long gene name | V-set and immunoglobulin domain containing 2 |
| Synonyms | CTXL CTH |
| Locus | 11q24, 2 |
| Discovery year | 2004-09-02 |
| GenBank acession | AF061022 |
| Entrez gene record | 23584 |
| Pubmed identfication | 9862345 |
| RefSeq identity | NM_014312 |
| Classification | I-set domain containing V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000150357 |